KEGG   Burkholderia thailandensis 2002721643: BG87_3027Help
Entry
BG87_3027         CDS       T03882                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bthl  Burkholderia thailandensis 2002721643
Pathway
bthl00620  Pyruvate metabolism
bthl00680  Methane metabolism
bthl00710  Carbon fixation in photosynthetic organisms
bthl01100  Metabolic pathways
bthl01120  Microbial metabolism in diverse environments
bthl01200  Carbon metabolism
Module
bthl_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bthl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BG87_3027
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BG87_3027
   00680 Methane metabolism
    BG87_3027
Enzymes [BR:bthl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BG87_3027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AJX99596
LinkDB All DBs
Position
I:3430352..3433336
Genome map
AA seq 994 aa AA seqDB search
MKSSGSARATRRNAVSSSSAPANAELPARRAAKTARKPNGAAARTIAPTNAASAKPHGRT
REDKDRPLFEDIRYLGRLLGDVVREQEGDAVFDVVETIRQTAVKFRREDDKTAAQTLEKM
LRKLTPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSAPQAGTVAYALDKLRQA
GDASSKTIKQFFEGALIVPVLTAHPTEVQRKSILDAQHDIARLLAERDQPLTARERAHNE
ALLRARVTTLWQTRMLRDARLTVADEIENALSYYRATFLDELPALYTDIEEALAEHGLPA
RVPAFFQMGSWIGGDRDGNPNVTAATLDEAINRQAAVIFEHYLEQVHKLGAELSVSNLLV
GASDALKALAAASPDQSPHRVDEPYRRALIGVYTRLAASARVRLGEGAVPVRSAGRGAAP
VRATPYADAEEFVADLRVLTDSLAVHHGESLATPRLAPLMRAAEVYGFHLASIDLRQSSD
IHEAVIAELLARGGVEPDYAALPEADKLRVLLAALADPRPLRSPYLDYSDLAKSELGVLE
RAHAIRAQFGARAVRNYIISHTETVSDLVEVLLLQKETGLFEGTLGAPHANARNGLMVIP
LFETIADLRNASDIMREFFALPGVGELLAHQGHEQEVMLGYSDSNKDGGFLTSNWELYRA
ELALVDLFHERGIKLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRLTEQGEVIASK
FANPEIGRRNLETVVAATLEATLAPHSNAPKQLPAFEAAMQTLSDAAMASYRALVYETPG
FTDYFFSSTPITEIAELNIGSRPASRKLQDPKHRKIEDLRAIPWGFSWGQCRLLLTGWYG
FGGAVAAYLDGAPDAAERGKRVALLRKMNKTWPFFANLLSNMDMVLAKTDLAVASRYAQL
VADKKLRKHVFERIVAEWHRTASALAEITGAQARLAANPLLARSIKNRFPYLDPLNHLQV
ELIKRHRAGDTNARLRRGIHLTINGIAAGLRNTG
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcttccggatcggcgcgcgcgacgcgccgcaatgctgtctcgtcctcctccgcc
ccggcgaacgccgagctccccgcccgccgcgccgcgaaaaccgcgcgcaagcccaacggc
gccgccgcgcgcacgatcgcgccgacgaatgccgcatccgcgaaaccgcacggccgcacg
cgcgaagacaaggatcgcccgctgttcgaggacatccgctatctgggccgcctgctcggc
gacgtcgttcgcgagcaggaaggcgacgccgtgttcgacgtcgtcgagacgatccgccag
accgccgtcaagttccgccgcgaggacgacaagaccgccgcgcagacgctcgagaagatg
ctgcgcaagctcacgcccgagcagacggtgagcgtcgtgcgcgcgttcagctatttctcg
cacctcgcgaacatcgccgaggaccgccaccacaaccgccgccgcagaatccacgcgctc
gcgggctccgcgccgcaggcgggcaccgtcgcgtacgcgctcgacaagctcaggcaggcg
ggcgacgcgtcgtcgaagacgatcaagcagttcttcgagggcgcgctgatcgtgcccgtg
ctgaccgcgcacccgaccgaagtgcagcgcaagagcattctcgacgcgcagcacgacatc
gcgcggctgctcgccgagcgcgaccagccgctcaccgcgcgcgagcgcgcgcacaacgag
gcgctgctgcgcgcgcgcgtgacgacgctctggcagacccggatgctgcgcgacgcgcgg
ctcaccgtcgccgacgagatcgagaatgcgctgtcgtactaccgcgcgacgttcctcgac
gagctgcccgcgctctacacggacatcgaggaggcgctcgccgagcacggcctgcccgcg
cgcgtgccggcgttcttccagatgggcagctggatcggcggcgaccgcgacggcaacccg
aacgtcaccgccgcgacgctcgacgaggcgatcaatcgccaggcggcggtgatcttcgag
cattacctggaacaggtgcacaagctgggcgcggagctctccgtgtcgaacctgctcgtc
ggcgcgagcgacgcgctgaaggcgctcgcggccgcgtcgccggaccagtcgccgcaccgc
gtcgacgagccgtaccgccgcgcgctgatcggcgtctacacgcggcttgcggcaagcgcg
cgcgtgcggctcggcgaaggcgcggtgcccgtgaggagcgcgggccgcggcgccgcgccc
gtgcgcgccacgccgtatgcggacgccgaggaattcgtggccgacctgcgcgtgctgacc
gattcgctcgccgtgcatcacggcgaatcgctcgcgacgccgcgcctcgcgccgctcatg
cgcgcggccgaggtgtacggctttcatctcgcgagcatcgacttgcggcaaagctcggac
atccatgaagcggtgatcgccgagctgctcgcgcgcggcggcgtcgagcccgactacgcg
gcgctgcccgaagcggacaagctgcgcgtgctgctcgcggcgctcgcggacccgcggccg
ctgcgctcgccgtatctcgactactcggacctcgcgaagagcgagctcggcgtgctcgag
cgcgcgcacgcgatccgcgcgcagttcggcgcgcgcgcggtgcgcaactacatcatttcg
cataccgagacggtgagcgacctcgtcgaagtgctgctgctgcagaaggaaacgggcctc
ttcgagggcacgctcggcgcgccgcacgcgaacgcgcgcaacggcctgatggtgattccg
ctcttcgagacgatcgccgacctgcgcaacgcgtccgacatcatgcgcgaattcttcgcg
ctgccgggcgtgggcgagctgctcgcgcaccagggccacgagcaggaagtgatgctcggc
tattcggacagcaacaaggacggcggcttcctcacgtcgaactgggagctctaccgcgcg
gaactggcgctcgtcgatctgttccacgagcgcgggatcaagctgcgcctgttccacggc
cgcggcggcacggtgggccgcggcggcggcccgacctatcaggcgattctgtcgcagccg
cccggcacggtgaacggccagatccggctcaccgagcagggcgaggtgatcgcgagcaag
ttcgcgaaccccgagatcggccggcgcaatctggagacggtcgtcgccgcgacgctcgag
gcgacgctcgcgccgcacagcaacgcgccgaagcagttgccggcgttcgaggcggcgatg
cagacgctgtccgatgcggcgatggcgtcgtaccgcgcgctcgtctacgagacgcccggc
tttaccgactacttcttctcgtcgacgccgatcaccgagatcgccgagctgaacatcggc
agccgccccgcgtcgcgcaagctgcaggacccgaagcaccgcaagatcgaggatctgcgc
gcgattccgtggggtttctcgtggggccagtgccggctgctgctgacgggctggtacggc
ttcggcggcgcggtagccgcgtatctcgacggcgcgccggacgcggccgagcgcggcaag
cgcgtcgcgctgctcaggaagatgaacaagacctggccgttcttcgcgaacctgctgtcg
aacatggacatggtgctcgcgaagaccgatctcgcagtcgcgtcgcgctacgcgcagctc
gtcgccgacaagaagctgcgcaagcacgtgttcgagcggatcgtcgccgaatggcaccgc
acggcgagcgcgctcgccgagatcaccggcgcgcaagctcggctcgccgcgaatccgctc
ctcgcgcgctcgatcaagaaccgcttcccgtacctcgatccgctgaaccacctgcaggtc
gagctgatcaagcggcaccgcgcgggcgacacgaacgcgcggctgcggcgcgggatccac
ctgacgatcaacgggatcgcggccggcctgcgcaatacgggctga

DBGET integrated database retrieval system