KEGG   Bacillus thuringiensis serovar kurstaki YBT-1520: YBT1520_25785Help
Entry
YBT1520_25785     CDS       T03435                                 

Definition
(GenBank) superoxide dismutase, Cu-Zn
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
bthr  Bacillus thuringiensis serovar kurstaki YBT-1520
Brite
Enzymes [BR:bthr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     YBT1520_25785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AHZ53731
LinkDB All DBs
Position
complement(4945358..4945897)
Genome map
AA seq 179 aa AA seqDB search
MKKRLFFSCCLLFLMAGCDQGKPKEIDVKLHNASGDEVGTAKVTQQTSGVKIKIKGEGFT
PGPHGIHVHEIGECKAPRFESSGNHFNPDNKKHGLLNPKGAENGDLPNVVADGSGKIKAE
IDAPHITLEEGKTTIHRKDGASIIITENPDDGMTQPTGKSGDRIACGVIVKKASDMKKK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacggctttttttcagttgttgtttactatttctgatggcaggttgtgaccaa
ggaaagccgaaagaaattgacgtgaaattacataatgcttcaggtgatgaagtggggact
gcgaaagtaactcagcaaacaagcggagtgaaaattaagattaaaggggaaggtttcacg
ccaggcccgcacggcatacatgtgcacgaaattggtgagtgtaaagcaccacgatttgaa
tcatctgggaatcattttaatcctgataataaaaagcatggactccttaatccgaagggt
gcagaaaacggtgatttaccgaacgtagttgcagatggttctggaaagattaaagcagaa
atcgatgcacctcacattacacttgaagaagggaaaacgacgattcatagaaaagatgga
gcgtctattattattacagaaaaccctgatgatggtatgacacaaccgacaggtaaatca
ggggatcgaattgcttgtggcgtaattgtaaaaaaagcatcggatatgaagaaaaagtaa

DBGET integrated database retrieval system