KEGG   Bacillus thuringiensis YBT-1518: YBT1518_03175Help
Entry
YBT1518_03175     CDS       T02930                                 

Definition
(GenBank) neutral protease
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
bthu  Bacillus thuringiensis YBT-1518
Brite
Enzymes [BR:bthu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     YBT1518_03175
Peptidases [BR:bthu01002]
 Metallo Peptidases
  Family M4: thermolysin family
   YBT1518_03175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP PepSY
Motif
Other DBs
NCBI-ProteinID: AHA69858
UniProt: V5M6S2
LinkDB All DBs
Position
700757..702457
Genome map
AA seq 566 aa AA seqDB search
MKKKSLALVLATGMAVTTFGGTGSAFADSKNVLSTKKYNETVQSPEFISGDLTEATGKKA
ESVVFDYLNAAKGDYKLGEKSAQDSFKVKQVKKDAVTDSTVVRIQQVYEGVPVWGSTQVA
HVSKDGSLKVLSGTVAPDLDKKEKLKNKNKIEGAKAIEIAQQDLGVTPKYEVEPKADLYV
YQNGEETTYAYVVNLNFLDPSPGNYYYFIEADSGKVLNKYNKLDHVANEDKSPIKQEAPK
QDAKAVVKPVTGTNKVGTGKGVLGDTKSLNTTLSGSSYYLQDNTRGATIFTYDAKNRTTL
PGTLWLDADNVFNAAYDAAAVDAHYYAGKTYDYYKATFNRNSINDAGAPLKSTVHYGSKY
NNAFWNGSQMVYGDGDGVTFTSLSGGIDVIGHELTHAVTENSSDLIYQNESGALNEAISD
IFGTLVEFYDNRNPDWEIGEDIYTPGKAGDALRSMSDPAKYGDPDHYSKRYTGTSDNGGV
HTNSGIINKQAYLLANGGTHSGVTVTGIGKDKLGAIYYRANTQYFTQSTTFSQARAGAVQ
AAADLYGASSAEVNAVKQSFSAVGVN
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaagtttagcgttagtgttagcgacaggaatggcagttacaacgtttgga
gggacaggctctgcgtttgcggattctaaaaatgtactctctacgaagaagtacaatgag
acagtacagtcacctgagtttatttctggtgatctaactgaagcaactggcaagaaagca
gaatctgttgtgtttgattacttaaacgcagcaaaaggtgattacaagctaggggaaaag
agtgcgcaagattctttcaaagtgaaacaagtgaagaaagatgctgtaactgattcaaca
gtagtacgtatacaacaagtttacgaaggagtgcctgtatggggttctactcaagtagct
cacgtaagtaaagacggttctttaaaagtattgtctggaacagttgcacctgatttggac
aaaaaggaaaagttgaaaaataaaaataagattgaaggcgcaaaagcaattgaaatcgcg
cagcaagatttaggggtaacaccgaaatatgaggtagaaccaaaagcggacttatatgta
tatcaaaatggtgaagaaacaacatatgcatatgttgtaaatctaaatttcttagatcca
agtccaggaaactactactatttcattgaagcagacagcggtaaagtattaaataaatat
aataaattggatcatgtagcaaatgaagataaatcaccaattaagcaagaggctcctaaa
caggatgcgaaagcagtagtaaaacctgtaacaggaacaaataaagtaggaactggtaaa
ggtgtattaggagatacgaaatcactcaatacaacattatctggctcatcttactactta
caagataatacgcgcggagcaacgattttcacatatgatgcgaaaaatcgtactacattg
ccaggaactttatggttagatgcagataatgttttcaatgcagcgtatgatgcagcggca
gtagatgctcattactatgcaggtaaaacatatgattattataaagctacatttaataga
aactctattaatgatgcaggggcaccgttaaaatcaacagttcattacggaagtaagtat
aataatgcattctggaacggctcacaaatggtatacggagatggagatggtgtaacattc
acttcattatctggtggaattgacgtaattggtcacgaattaacgcatgctgttacggaa
aatagctcggacttaatttatcaaaatgaatcaggagcgttaaatgaagcgatttctgat
atctttggtactttagtagaattctatgataaccgtaacccagattgggagattggtgaa
gatatttacacgcctggtaaagcaggagatgcgcttcgctctatgagtgatccagcgaaa
tatggtgacccagaccattattctaagcgttacactggtactagtgataacggtggggtt
catacaaacagtggtatcattaacaaacaagcttatttattagcaaatggtggtacgcat
tcgggtgtaactgtaacgggcattggtaaagataagttaggtgcaatttattaccgtgca
aatacacaatatttcacgcaatctactacatttagccaagctcgtgctggtgcagtacaa
gctgcagcggatttatatggtgctagctctgcagaagtaaatgcagtgaagcaatcattt
agtgctgttggtgtaaattaa

DBGET integrated database retrieval system