KEGG   Bacillus thuringiensis HD-771: BTG_27755Help
Entry
BTG_27755         CDS       T02293                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bti  Bacillus thuringiensis HD-771
Brite
Enzymes [BR:bti01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BTG_27755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AFQ18950
UniProt: J4A1F5
LinkDB All DBs
Position
5413323..5413934
Genome map
AA seq 203 aa AA seqDB search
MAKHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVA
NLNEVPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQPVGELATAIEAKFGSFDAFKEEF
AKAGATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRRP
DYIGAFWNVVDWNAAEKRYQEAK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacacgaattaccaaatttaccttatgcgtatgatgctttagagcctcacttt
gacaaagaaacaatgaacatccatcatacaaaacatcacaacacgtatattacaaactta
aacgctgctttagaaggtcatgcagaattagctgacaaaagcgtagaagaattagttgca
aacttaaacgaagtaccagaagcgatccgtacagcagtacgtaacaatggtggcggacac
gctaaccatacattcttctggacaatcttatctccaaacggcggaggacaacctgtaggt
gaacttgcaactgcaattgaagcgaaattcggtagcttcgatgcattcaaagaagaattc
gcaaaagctggcgcaactcgcttcggttctggttgggcttggttagtagtaaacaatggt
gagttagaagtaacaagcactccaaaccaagattctcctttaactgaaggtaaaactcca
gttatcggtttagatgtttgggagcacgcttactacttaaactaccaaaaccgtcgtcca
gactacatcggcgcattttggaacgttgtagattggaacgctgctgaaaaacgttaccaa
gaagcaaaataa

DBGET integrated database retrieval system