KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_0509Help
Entry
BT9727_0509       CDS       T00179                                 

Gene name
npr
Definition
(RefSeq) bacillolysin (thermolysin-like metalloprotease, peptidase M4)
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Brite
Enzymes [BR:btk01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     BT9727_0509 (npr)
Peptidases [BR:btk01002]
 Metallo Peptidases
  Family M4: thermolysin family
   BT9727_0509 (npr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP PepSY
Motif
Other DBs
NCBI-GeneID: 2856463
NCBI-ProteinID: YP_034856
UniProt: Q6HNL5
LinkDB All DBs
Position
602189..603889
Genome map
AA seq 566 aa AA seqDB search
MKKKSLALVLATGMAVTTFGGTGSAFADSKNVLSTKKYNETVQSPEFVSGDLTEATGKKA
ESVVFDYLNAAKGDYKLGEKSAQDSFKVKQAKKDAVTDSTVLRLQQVYEGVPVWGSTQVA
HVSKDGSLKVLSGTVAPDLDKKEKLKNKNKIEGAKAIEIAQKDLGVTPKYEVEPKADLYV
YQNGEETTYAYVVNLNFLEPSPGNYYYFIEADSGKVLNKYNKLDHVANEDKSPVKQEAPK
QEAKPAVKPVTGTNAVGTGKGVLGDTKSLNTTLSASSYYLQDNTRGATIFTYDAKNRSTL
PGTLWVDADNVFNAAYDAAAVDAHYYAGKTYDYYKATFNRNSINDAGAPLKSTVHYGSRY
NNAFWNGSQMVYGDGDGVTFTSLSGGIDVIGHELTHAVTEYSSDLIYQNESGALNEAISD
VFGTLVEFYDNRNPDWEIGEDIYTPGKAGDALRSMSDPTKYGDPDHYSKRYTGTSDNGGV
HTNSGIINKQAYLLANGGTHYGVTVTGIGKDKLGAIYYRANTQYFTQSTTFSQARAGAVQ
AAADLYGANSAEVNAVKQSFSAVGIN
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaagtttagcgttagtgttagcaacaggaatggcagttacaacgtttgga
gggacaggctctgcttttgcagattctaaaaatgtgctctctacgaagaagtacaatgag
acagtacagtcaccggagtttgtttctggggatttaactgaagcaactggtaagaaagca
gaatctgttgtgtttgattacttaaatgcagcaaaaggtgattataagttaggggaaaag
agtgcgcaagattctttcaaagtgaaacaagcgaagaaagatgctgtaactgattcaaca
gtattacgtttgcaacaagtttacgaaggagtacctgtatggggttctacgcaagtagct
cacgtaagtaaagatggttctttaaaagtattgtctggaacagttgcacctgatttagac
aaaaaagaaaagttgaaaaataaaaataagatcgaaggcgcaaaagcaattgaaattgcg
caaaaagatttaggtgttacaccgaaatatgaggtagaaccaaaagcggacttatatgta
tatcaaaatggtgaagaaacaacatatgcatacgttgtaaatttaaacttcttagagcca
agcccaggaaactactactatttcattgaagcagacagcggtaaagtattaaataaatat
aataaattggatcatgtagcaaatgaagataagtcaccagttaagcaagaggcacctaaa
caagaagcgaaaccggctgtaaagcctgtaacaggcacaaatgcagtgggtactggtaaa
ggtgtattaggagatacgaagtcacttaatacaacgttatctgcatcatcttactattta
caagataatacgcgcggagcaacgattttcacatatgatgcgaaaaaccgctcaacatta
ccaggaacgttatgggtagatgcggataatgttttcaatgcagcgtatgatgcagcggca
gtagatgctcactactatgcgggtaaaacatatgattactataaagctacatttaataga
aactctattaatgatgcaggagcgccattaaaatcaacagttcattatggaagtagatat
aataatgcgttctggaatggctctcaaatggtatacggagatggtgatggtgtaacattc
acttcattgtctggtggaattgatgtaattggccatgaattaacgcatgctgttacagag
tatagctcagatttaatttatcaaaatgaatcaggagcattaaatgaagctatttcggat
gtttttggtactttagtagaattctatgataaccgtaacccagattgggaaattggtgaa
gatatttatacgcctggtaaagcaggagatgcgcttcgctctatgagtgatccaacgaaa
tatggtgatccagatcattattctaagcgttacactggtactagtgataacggtggggtt
catacgaacagtggtattattaacaaacaagcttatttattagcaaatggtggtacacat
tacggtgtaactgtaactggtatcggtaaagataagctaggtgcaatttattaccgtgca
aacacacaatatttcacgcaatctactacatttagtcaagcgcgtgctggtgcagtacaa
gctgcagctgatttatatggtgcgaactctgctgaagtaaatgcagttaagcaatcattt
agtgctgttggtattaactaa

DBGET integrated database retrieval system