KEGG   Bacillus thuringiensis Al Hakam: BALH_0539Help
Entry
BALH_0539         CDS       T00429                                 

Gene name
nprE
Definition
(GenBank) thermolysin, Metallo peptidase, MEROPS family M04
  KO
K01400  
bacillolysin [EC:3.4.24.28]
Organism
btl  Bacillus thuringiensis Al Hakam
Brite
Enzymes [BR:btl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     BALH_0539 (nprE)
Peptidases [BR:btl01002]
 Metallo Peptidases
  Family M4: thermolysin family
   BALH_0539 (nprE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
625608..627308
Genome map
AA seq 566 aa AA seqDB search
MKKKSLALVLATGMAVTTFGGTGSAFADSKNVLSTKKYNETVQSPEFISGDLTEATGKKA
ESVVFDYLNAAKGDYKLGEKSAQDSFKVKQAKKDAVTDSTVLRLQQVYEGVPVWGSTQVA
HVSKDGSLKVLSGTVAPDLDKKEKLKNKNKIEGAKAIEIAQKDLGVTPKYEVEPKADLYV
YQNGEETTYAYVVNLNFLEPSPGNYYYFIEADSGKVLNKYNKLDHVANEDKSPVKQEAPK
QEAKPAVKPVTGTNAVGTGKGVLGDTKSLNTTLSASSYYLQDNTRGATIFTYDAKNRSTL
PGTLWVDADNVFNAAYDAAAVDAHYYAGKTYDYYKATFNRNSINDAGAPLKSTVHYGSRY
NNAFWNGSQMVYGDGDGVTFTSLSGGIDVIGHELTHAVTEYSSDLIYQNESGALNEAISD
VFGTLVEFYDNRNPDWEIGEDIYTPGKAGDALRSMSDPTKYGDPDHYSKRYTGTGDNGGV
HTNSGIINKAAYLLANGGTHYGVTVNGIGKDKVGAIYYRANTQYFTQSTTFSQARAGLVQ
AATDLYGASSAEVAAVKQSYSAVGVN
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaagtttagcgttagtgttagcgacaggaatggcagttacaacgtttgga
gggacaggctctgcttttgcagattctaaaaatgtgctctctacgaagaagtacaatgag
acagtacagtcaccggagtttatttctggggatttaactgaagcaactggtaagaaagca
gaatctgttgtgtttgattacttaaatgcagcaaaaggtgattataagttaggggaaaag
agtgcgcaagattctttcaaagtgaaacaagcgaagaaagatgctgtaactgattcaaca
gtattacgtttgcaacaagtttacgaaggagtacctgtatggggttctacgcaagtagct
cacgtaagtaaagatggttctttaaaagtattgtctggaacagttgcacctgatttagac
aaaaaagaaaagttgaaaaataaaaataagatcgaaggcgcaaaagcaattgaaattgcg
caaaaagatttaggggtaacacctaaatatgaggtagaaccaaaagcggacttatatgta
tatcaaaacggtgaagaaacaacatatgcatacgttgtaaatttaaacttcttagagcca
agcccaggaaactactactatttcattgaagcagacagcggtaaagtattaaataaatat
aataaattggatcatgtagcaaatgaagataagtcaccagttaagcaagaggcacctaaa
caagaagcgaaaccagctgtaaagcctgtaacaggcacaaatgcagtgggtactggtaaa
ggtgtattaggagatacgaagtcacttaatacaacgttatctgcatcatcttactattta
caagataatacgcgcggagcaacgattttcacatatgatgcgaaaaatcgctcaacatta
ccaggaacgttatgggtagatgcggataatgttttcaatgcagcgtatgatgcagcggca
gtagacgctcattactatgcgggtaaaacatatgattactataaagctacatttaataga
aactctattaatgatgcaggagcgccattaaaatcaacagttcattatggaagtagatat
aataatgcgttctggaatggctctcaaatggtatacggagatggtgatggtgtaacattc
acttcattgtctggtggaattgatgtaattggccatgaattaacgcatgctgttacagag
tatagctcagatttaatctatcaaaatgaatcaggagcattaaatgaagctatttcagat
gtatttggtactttagtagaattctatgataaccgtaacccagattgggaaattggtgaa
gatatttatacgcctggtaaagcaggagatgcgcttcgctctatgagtgatccaacaaaa
tatggtgatccagatcattattctaagcgttacacaggtactggtgataacggtggcgtt
catacaaatagcggtattattaacaaagcggcttacttattagcgaatggtggtacgcat
tacggtgttactgtgaacggtattggtaaagataaagtaggagcgatttattaccgtgca
aatacgcaatatttcacgcaatctactacttttagtcaagctcgtgctggattagtacaa
gctgcaactgacttatatggtgctagctctgcagaagtagcagcagttaagcaatcatat
agtgctgttggtgtaaactaa

DBGET integrated database retrieval system