KEGG   Bacillus thuringiensis MC28: MC28_3249Help
Entry
MC28_3249         CDS       T02263                                 

Gene name
tgl
Definition
(GenBank) Protein-glutamine gamma-glutamyltransferase
  KO
K00686  
protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13]
Organism
btm  Bacillus thuringiensis MC28
Brite
Enzymes [BR:btm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     MC28_3249 (tgl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3181122..3181952
Genome map
AA seq 276 aa AA seqDB search
MIVIGRSIVHPYITNEYEPFAAEKQQILSIMAGNQEVYSFRTADELSFDLNLRVNIIISA
LELFQSGFQFRTFQQSFCNPQFWKRTSLGGFQLLPNIPPSIAIQDIFKNGKLYGTECATA
MIIIFYKALLSLYEEETFNRLFANLLLYTWDYDQDLKLITKTGGDLVPGDLVYFKNPQVN
PATIEWQGENTIYLGNFFFYGHGVGVKTKEEIIYSLNERRVPYAFISAFLTDTITRIDSR
IMSQYASPNTPQTAIGFIPIRDDAIVATVGHTTTIY
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgattgtaataggtcgttctattgtacacccttatatcacaaatgaatatgagccattt
gcagctgagaagcaacaaattttatccataatggcaggaaatcaagaagtttattccttc
cgaactgctgacgaactcagctttgatttaaatttgcgagttaatattattatttctgca
ttagaactttttcaaagtggatttcagtttcgtacgtttcaacaatccttttgcaacccc
cagttttggaaaagaacatctttagggggattccaactacttccaaatataccaccttct
attgccatacaagatattttcaaaaacgggaaactatatgggactgaatgcgcaaccgct
atgataattattttttacaaagctttactatcattgtatgaggaagaaaccttcaatcgc
ctttttgcaaatcttttactttatacttgggactacgatcaagatttaaaactcataaca
aaaacaggtggcgaccttgttcctggcgatctcgtttactttaaaaacccacaagtgaat
ccagctacgattgagtggcaaggagaaaacacaatctatctaggaaatttctttttttac
ggacatggcgtaggtgtaaaaacaaaagaagaaattatctactcattaaatgaacgacgc
gtcccttacgcttttatttcagcttttttgaccgatactattactcgtattgatagccgt
ataatgagtcaatacgcctctccaaacacaccacaaacagccatagggtttattccgatt
agagatgatgcaatcgttgctacagttggccatacaactacaatttattaa

DBGET integrated database retrieval system