KEGG   Bacillus thuringiensis HD-789: BTF1_19985Help
Entry
BTF1_19985        CDS       T02411                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
btn  Bacillus thuringiensis HD-789
Brite
Enzymes [BR:btn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BTF1_19985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(3859808..3860419)
Genome map
AA seq 203 aa AA seqDB search
MAKHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVA
NLNEVPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQPVGELATAIEAKFGSFDAFKEEF
AKAGATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRRP
DYIGAFWNVVDWNAAEKRYQQAK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacacgaattaccaaatttaccttatgcgtatgatgctttagagcctcacttt
gacaaagaaacaatgaacatccatcatacaaaacatcacaacacgtatattacaaactta
aacgctgctttagaaggtcatgcagaattagctgacaaaagcgtagaagaattagttgca
aacttaaacgaagtaccagaagcgatccgtacagcagtacgtaacaatggtggcggacat
gctaaccatacattcttctggacaatcttatctccaaacggcggaggacaacctgtaggt
gaacttgcaactgcaattgaagcgaaattcggtagcttcgatgcattcaaagaagaattc
gcaaaagctggcgcaactcgcttcggttctggttgggcttggttagtagtaaacaatggt
gagttagaagtaacaagcactccaaaccaagattctcctttaactgaaggtaaaactcca
gttatcggtttagatgtttgggagcacgcttactacttaaactaccaaaaccgtcgtcca
gactacatcggcgcattttggaacgttgtagattggaacgctgctgaaaaacgttaccaa
caagcaaaataa

DBGET integrated database retrieval system