KEGG   Burkholderia thailandensis 2002721723: BTQ_4231Help
Entry
BTQ_4231          CDS       T03111                                 

Definition
(GenBank) acyltransferase family protein
Organism
btq  Burkholderia thailandensis 2002721723
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2:1148039..1150876
Genome map
AA seq 945 aa AA seqDB search
MEHTQRLSDNATRLLALIDALLAELYGERNGHGRATLDARFERDLGFDSLTRAELFDRIE
RAFGVRLPVDVFASAATPADVVRALAAAHAQPQAAPEGEAGPAPPADAAAWPVEADTLID
VLNWHAERHPDRVHLRLLEDGLVATPLAYGELHRRASDLAGGLRERGIDPGDTVALMLPT
GLDYFVSFTAVLFCGAIPVPIYPPANPAQLEEHVERHTPILENARIKALIAFRQAVSVAQ
LLKLRVSTLQHVFTPEQLVGRERLPPFRAAASDIALLQYTSGSTGTPKGVVLSHANLLAN
IRAMGDRMHVYATDVLVSWLPLYHDMGLIGAWLAPLYFGIPAVVMSPVAFLARPALWLRA
ISRYHGTITAAPNFAYERCARHLAALEPTEFDLSSLRFAFCGAEPVNADTLRAFAARFAA
CGFDARALTPVYGLAENTLGLTFPPPARGLHVDRIARAPLNASGQAVPAPGDANALDVPG
CGYPIDGTELRIVGDDERELAERRVGRIEFRGTSATRGYYRNPAQTARLFHDAWRDTGDL
GYVADGELYITGRAKDMIIRGGQHFFPYELEEAIGRLPGVAAGGVAVCGAADPASGTERV
VIFVESEAADGAACERLRANVNDVTAARWGMPAEQVSIVAPHSILKTPSGKIRHAATLAQ
FERCAGRLPQASAPWRQFADLAVRSVAPFCSRVSRRAAQALRGLCCWALVALLAPVLWVR
VAYRNDTRDNWRLAAQACRAFLRFADVRASLIADPDALAAGPSIVVANHTSYLDVVALLA
LLPSPVHFVAKRELATRPFVGRFLRALGTRFVERRDYGRSVEDEARLVAQAAADETLLFF
PEGTFTRAAGLAAFRLGAFRAACIARRPVVPVVVSGARAVLRDGEWAPRRGEIAVTMLAP
IFPDGTDFGAMARLRDRARDAILSRCGEPDLRADRAPRAAFASVA
NT seq 2838 nt NT seq  +upstreamnt  +downstreamnt
atggaacacacgcagcgcctatccgacaacgcgacgcgtctgctcgcgctgatcgacgca
ttgctcgccgagttgtacggcgagcgaaacggtcatggccgcgcgacgctcgatgcgcgg
ttcgagcgcgatctcggcttcgacagcctgacgcgcgcggagctgttcgaccggatcgag
cgcgcgttcggcgtgcgcttgccggtcgacgtgttcgcgtccgccgcgacgcccgccgac
gtcgtgcgcgcgctcgccgcagcgcacgcgcagccgcaggccgcgccggaaggcgaagcg
gggccggcgccgcccgccgatgccgccgcatggcccgtcgaggccgacacgctgatcgac
gtgttgaactggcatgccgagcggcatccggatcgcgttcatctgcggcttctcgaagac
ggcctcgtcgcgacgccgctcgcttacggcgaactgcatcggcgcgcgtcggatctggcg
ggcggcttgcgcgaacgcggcatcgatccgggcgacacggtcgcgctgatgctgccgacg
gggctcgactatttcgtctcgttcaccgccgtcctgttttgcggcgcgatcccggtgccg
atctatccgcccgcgaatcccgcgcagctcgaagagcatgtcgagcgccacacgccgatt
ctcgagaacgcccggatcaaggcgctgatcgcgtttcgccaggccgtctcggtcgcgcag
ttgctgaagcttcgcgtgagcacgctgcagcacgtgttcacgcccgagcagctcgtcggc
cgcgagcggctgccgccgtttcgcgcggccgcgagcgacatcgcgctgctccagtacacg
tcgggcagcaccggcacgccgaagggcgtggtgctcagccatgcgaacctgctcgcgaac
atccgcgcgatgggcgaccggatgcatgtctacgcgaccgacgtgctcgtgagctggttg
ccgctgtatcacgacatgggattgatcggcgcatggctcgcgccgctttatttcggcatt
ccggcggtcgtgatgtcgcccgtcgcgttcctcgcgcgtccggcgctgtggctgcgcgcg
atctcgcgataccacggcacgatcaccgccgcgccgaacttcgcgtacgaacggtgcgcg
cgccatctcgccgcgctcgagccgaccgaattcgatctgtcgtcgctgcgtttcgcattc
tgcggcgccgagcccgtcaacgccgacacgctgcgcgcgttcgcggcgcgcttcgccgcg
tgcggtttcgacgcgcgcgcgctgacgcccgtctacggtctcgcggaaaacacgctcggc
ctgacgtttccgccgcccgcgcgcgggctgcatgtcgatcggatcgcccgcgcgccgctc
aacgcgagcggccaggcggtgcccgcgcccggcgacgcgaacgcgctcgacgtgccgggc
tgcggctatccgatcgacggcaccgagctgcggatcgtcggcgacgacgagcgcgagctt
gccgagcggcgggtggggcgcatcgagtttcgcggcacgtcggcgacgcgcggctactac
cgcaatccggcgcagaccgcgcgcctgttccatgacgcatggcgcgacaccggcgacctc
ggctatgtcgcggacggcgagctgtacatcaccgggcgcgcgaaggacatgatcatccgc
ggcggccagcatttctttccgtacgagctcgaggaggcgatcggacggctgccgggcgtc
gcggcgggcggcgttgcggtgtgcggcgccgccgaccccgccagcggcaccgagcgcgtc
gtgatcttcgtcgagagcgaggccgccgacggcgccgcgtgcgagcggctgcgggcgaac
gtcaacgacgtgacggccgcgcgctggggcatgcccgccgaacaggtgagcatcgtcgcg
ccgcacagcatcctgaagacgccgagcggcaagatccgccacgcggcgacgctcgcgcag
ttcgagcgctgcgccggacggttgccgcaagcgagcgcgccgtggcggcaattcgccgat
ctggcggtgcgcagcgtcgcgccgttctgctcgcgcgtttcgcggcgcgcggcgcaggcg
ctgcgcgggctgtgctgctgggcgctcgtcgcgctgctcgcgcccgtgctgtgggtgcgc
gtcgcgtatcggaacgatactcgggacaactggcggctcgcggcgcaagcgtgccgcgcg
ttcctgcgtttcgccgacgtgcgcgcgagcctgatcgccgatcccgacgcgctcgcggcc
gggccgtcgatcgtcgtcgcgaaccataccagctacctggacgtcgtcgcgctgctggcg
ttgctgccgagtcccgtgcacttcgtcgcgaagcgcgagctcgcgacgcgcccgttcgtc
ggccgcttcctgcgcgcgctcggcacgcgcttcgtcgagcggcgcgattacgggcgcagc
gtcgaggacgaagcgcggctcgtcgcgcaggcggccgccgacgagacgctgctgtttttt
ccggaaggcacgttcacgcgcgcggcggggctcgccgcgttccgcctcggcgcgtttcgc
gcggcgtgcatcgcgcggcggccggtggtgcccgtcgtcgtgagcggcgcgcgcgccgtg
ttgcgcgacggcgaatgggcgccgcgccgcggggagatcgcggtgacgatgctcgcgccg
atcttcccggacggcacggacttcggcgcgatggcgcggcttcgcgatcgcgcgcgcgat
gcgattctgtcgcgctgcggcgagcccgacttgcgggccgatcgcgctccgcgcgcggcg
ttcgcgtcggtcgcgtaa

DBGET integrated database retrieval system