KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-189: F543_20160Help
Entry
F543_20160        CDS       T03018                                 

Definition
(GenBank) Elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
btrh  Bibersteinia trehalosi USDA-ARS-USMARC-189
Brite
Translation factors [BR:btrh03012]
 Eukaryotic Type
  Elongation factors
   F543_20160
 Prokaryotic Type
   F543_20160
Mitochondrial biogenesis [BR:btrh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    F543_20160
Exosome [BR:btrh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   F543_20160
  Exosomal proteins of breast cancer cells
   F543_20160
  Exosomal proteins of colorectal cancer cells
   F543_20160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2091637..2092824
Genome map
AA seq 395 aa AA seqDB search
MAKEQFNRGDKVHVNVGTIGHVDHGKTTLTAAITTVLAKHFGGAARAFDQIDNAPEEKAR
GITINTSHVEYETATRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREH
ILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYEFPGDDTPIVRGSALQAL
NGVPEWEEKILELAGHLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKS
GEEVEIVGIKETTKTTVTGVEMFRKLLDEGRAGENVGALLRGTKREEIERGQVLAKPGSI
TPHTDFESEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKM
TVNLIHPIAMDEGLRFAIREGGRTVGAGVVAKIIK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaacagtttaaccgtggtgataaagtccacgtaaacgtgggtacaatcggt
cacgttgaccatggtaaaaccactttaacagcagcaattactaccgttttagcaaaacac
ttcggtggtgcagctcgtgcattcgaccaaatcgacaatgcaccagaagaaaaagcgcgt
ggtatcaccatcaacacttcacacgttgaatacgaaaccgcaactcgtcactatgctcac
gttgactgcccaggacacgcggactatgtgaaaaacatgatcaccggtgcggcacaaatg
gacggcgctatcttagtagtagcagcaacagacggtcctatgccacaaactcgtgagcac
atcttattaggtcgccaagtaggtgttccatacatcatcgtattcttaaacaaatgcgac
atggtagatgacgaagagttattagaattagttgaaatggaagttcgtgaacttctttct
caatacgaattcccaggtgatgacacaccaatcgtacgtggttctgcgttacaagcatta
aacggcgtaccagagtgggaagaaaaaatccttgaattagcaggtcacttagactcttac
attccagagccagagcgtgcgattgataaaccattcttattaccaatcgaagacgtattc
tcaatctctggtcgtggtactgtagtaacaggtcgtgttgagcgtggtatcatcaaatca
ggtgaagaagtagaaatcgttggtatcaaagaaactaccaaaactactgtaactggtgtt
gagatgttccgtaaattacttgacgaaggtcgtgcaggtgagaacgtaggtgcattatta
cgtggtactaaacgtgaagaaatcgaacgtggtcaagtacttgctaaaccaggttcaatc
acgccacacacagacttcgaatcagaagtttacgtattatcaaaagaagaaggtggtcgt
cacactccattcttcaaaggttaccgtccacagttctacttccgtacaactgacgtaaca
ggtacaatcgagttaccagaaggtgttgaaatggtaatgccaggcgacaacatcaaaatg
actgtaaacttaattcacccaatcgcaatggacgaaggtttacgttttgcgattcgtgaa
ggtggtcgtacagtaggtgcgggcgttgtagcgaaaatcatcaaataa

DBGET integrated database retrieval system