KEGG   Bordetella trematum: SAMEA390648700029Help
Entry
SAMEA390648700029 CDS       T04322                                 

Gene name
goaG2_1
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
btrm  Bordetella trematum
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:btrm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SAMEA390648700029 (goaG2_1)
   00650 Butanoate metabolism
    SAMEA390648700029 (goaG2_1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAMEA390648700029 (goaG2_1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAMEA390648700029 (goaG2_1)
Enzymes [BR:btrm01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SAMEA390648700029 (goaG2_1)
Amino acid related enzymes [BR:btrm01007]
 Aminotransferase (transaminase)
  Class III
   SAMEA390648700029 (goaG2_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:39251..40516
Genome map
AA seq 421 aa AA seqDB search
MKNRDLNTRRALATPRGVGVMCDFYAVRAENATLWDAEGKEYIDFAGGIAVLNTGHRHPK
VKAAIAAQLENFTHTAYQIVPYEGYVALAERINALAPISGLKKTAFFTTGVEAVENALKI
ARAATGRSGVIAFSGAFHGRTHMGMALTGKVAPYKVDFGAMPADVYHVPFPNATQDISIA
DSLKALDLLFKVDIDPKRVAAIILEPVQGEGGFNITPPELMTALRKVCDEHGILLIADEV
QTGFARTGKLFAMEHHSVQADLITMAKSLGGGMPISGVVGRADVMDAPGPGGLGGTYAGN
PLAVASALAVLDVIAEEKLCERSVTLGKRLTDRLNSLRAKVPGIADVRALGSMVALELND
PATGKPDAEAVKRVQQKAIEKGLLLLSCGVYGNVLRFLYPLTIPDAQFDRALDILAEALS
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccgtgatctgaacacccgtcgcgctctggccactccgcgtggcgtgggcgtc
atgtgcgatttctacgctgtgcgcgccgagaacgccacgctgtgggatgccgaaggcaag
gaatatatcgacttcgccggcggcattgcggtgctgaacaccggccaccgccatccgaag
gtcaaggcggccatcgccgcgcaactcgaaaacttcacccacaccgcctaccagatcgtg
ccctatgagggctacgtggccctggccgaacgcatcaacgccctggcgcccatcagcggc
ctgaagaagaccgccttcttcaccaccggcgtcgaggccgtcgagaacgccctcaagatc
gcccgggccgccactggccgcagcggcgtgatcgccttctccggcgccttccacggccgc
acccacatgggcatggccctgaccggcaaggtcgcgccctacaaggtggatttcggcgcc
atgccggctgacgtctaccacgtgccgttccccaacgccacccaggacatctcgatcgcc
gattcgctcaaggcgctggacctgctgttcaaggtcgacatcgatcccaagcgcgtggcg
gccatcattctcgaacccgtgcagggcgagggaggcttcaacatcaccccgccggagctc
atgacggcgctgcgcaaggtctgcgacgagcatggcatcctgctgatcgccgacgaagtc
cagaccggctttgcccgcaccggcaagctgtttgccatggagcaccactcggtgcaggcc
gatctcatcaccatggccaaaagcctgggcggcggcatgccgatctcgggtgtcgtgggc
cgcgccgacgtgatggacgcccccggcccgggcggcctgggcggcacctacgccggcaac
ccgctggccgtcgcgtcggcgctggcggtgctcgacgtgatcgccgaggaaaaactgtgc
gagcgctccgtgacgctgggcaagcgcctgaccgatcgcctgaacagcctgcgcgccaag
gtgccgggcatcgccgatgtgcgtgccctgggctcgatggtggccctggagctcaatgac
ccggccaccggcaagccggacgccgaggccgtcaagcgcgtgcagcagaaagccatcgag
aaaggcctgctgctgctgagctgcggcgtgtatggcaacgtgctgcgcttcctgtatcct
ttgaccattcccgatgcgcagttcgatcgcgcactggatatcctggccgaagccctgagc
gcctga

DBGET integrated database retrieval system