KEGG   Bordetella trematum: SAMEA390648700045Help
Entry
SAMEA390648700045 CDS       T04322                                 

Gene name
gst_1
Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
btrm  Bordetella trematum
Pathway
btrm00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:btrm00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SAMEA390648700045 (gst_1)
Enzymes [BR:btrm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SAMEA390648700045 (gst_1)
Transporters [BR:btrm02000]
 Other Transporters
  Pores ion channels [TC:1]
   SAMEA390648700045 (gst_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-ProteinID: SAI66006
UniProt: A0A157Q9C5
LinkDB All DBs
Position
1:complement(57550..58170)
Genome map
AA seq 206 aa AA seqDB search
MSRWVFYSAPGTCALATHIALHEAGVEFDLVKLDFGANQQQSPEFLRVNPKGRVPALQTE
RGVLTETPALLAFVAQSFPQARLAPLDDAFAFARLQELTSYLSSTVHVAHAHKRRGARWV
DDPAAEEAMRAKVPQTMTACAAFLESQIAGTWAMGEQFSVVDGYIYTVGVWMQGDGVDLT
RFPKLSGLLARVAARPSAQRAIAEAA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgttgggttttttattctgcgccgggtacctgtgcccttgccacccatattgca
ttgcatgaagccggcgtcgagttcgatctggtgaaactggatttcggcgccaatcagcag
cagagcccggagttcctgcgcgtcaatcccaaggggcgggtgcctgcgttgcagaccgaa
cgcggcgtgctgaccgaaacgcctgcactgctggctttcgtggcgcaatcctttccccag
gcccgcttggcgccgctggacgatgcctttgcctttgcccggctgcaggagttgaccagc
tatctgtcttccaccgtgcatgtggcgcacgcccataagcggcgcggcgcgcgctgggtc
gacgatcctgccgccgaagaggccatgcgtgccaaggtgccgcagaccatgacggcctgc
gccgctttcctcgagtcgcagattgccggcacctgggcaatgggcgaacaattttccgtg
gtcgatggttatatctacacggtgggcgtctggatgcagggcgacggcgtggatctgacc
cgcttccccaagctcagcggcttgctggcgcgtgtggcggcgcgcccgagcgcgcagcgc
gcgatcgccgaagcggcctga

DBGET integrated database retrieval system