KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_0673Help
Entry
HD73_0673         CDS       T02460                                 

Definition
(GenBank) Bacillolysin
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Brite
Enzymes [BR:btt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     HD73_0673
Peptidases [BR:btt01002]
 Metallo Peptidases
  Family M4: thermolysin family
   HD73_0673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP PepSY
Motif
Other DBs
NCBI-ProteinID: AGE76252
LinkDB All DBs
Position
683913..685613
Genome map
AA seq 566 aa AA seqDB search
MKKKSLALVLATGMAVTTFGGTGSAFADSKNVLSTKKYNETVQSPEFISGDLTEATGKKA
ESVVFDYLNAAKGDYKLGEKSAQDSFKVKQVKKDAVTDSTVVRMQQVYEGVPVWGSTQVA
HVSKDGSLKVLSGTVAPDLDKKEKLKNKNKIEGAKAIEIAQQDLGVTPKYEVEPKADLYV
YQNGEETTYAYVVNLNFLDPSPGNYYYFIEADSGKVLNKFNTIDHVTNDDKSPVKQEAPK
QDAKAVVKPVTGTNKVGTGKGVLGDTKSLNTTLSGSSYYLQDNTRGATIFTYDAKNRSTL
PGTLWADADNVFNAAYDAAAVDAHYYAGITYDYYKNTFNRNSINDAGAPLKSTVHYGSNY
NNAFWNGSQMVYGDGDGVTFTSLSGGIDVIGHELTHAVTENSSNLIYQNESGALNEAISD
IFGTLVEFYDNRNPDWEIGEDIYTPGKAGDALRSMSDPTKYGDPDHYSKRYTGSSDNGGV
HTNSGIINKQAYLLANGGTHYGVTVNGIGKDKLGAIYYRANTQYFTQSTTFSQARAGAVQ
AAADLYGANSAEVAAVKQSFSAVGIN
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaagagtttagcattagtgttagcgacaggaatggcagttacaacgtttgga
gggacaggctctgcgtttgcggattctaaaaatgtgctctctactaagaagtacaatgag
acggtgcagtcacctgagtttatttctggtgatctaactgaagcaactggcaagaaagca
gaatctgttgtgtttgattacttaaacgcagcaaaaggtgattacaagctaggggaaaag
agtgcacaagattctttcaaagtgaaacaagtgaagaaagatgctgtaactgattcaaca
gtagtacgtatgcaacaagtttacgaaggagtgcctgtatggggttctactcaagtagct
cacgtaagtaaggacggttctttaaaagtattgtctggaacagttgcacctgatttagac
aaaaaggaaaagttgaaaaataaaaataagattgaaggcgcaaaagcaattgaaatcgcg
cagcaagatttaggggtaacaccgaaatatgaagtagaaccaaaagcggacttatatgta
tatcaaaacggtgaggaaacaacatatgcatatgttgtaaatctaaacttcttagatcca
agcccaggaaactactactatttcattgaggcagacagcggtaaagtattaaataagttt
aatacaattgatcatgtgacgaatgatgataagtcaccagttaagcaagaggctcctaaa
caggatgcgaaagctgttgtaaagcctgtaacaggaacgaataaagtaggaactggtaaa
ggcgtactaggagatacgaagtctcttaatacaacgttatctggatcatcttactactta
caagataatacacgcggggcaacgattttcacatatgatgcgaaaaaccgttcaacatta
ccaggaacattatgggcagatgcagataatgttttcaatgcagcgtatgatgcagcagcg
gtagatgctcattactatgcgggtatcacgtatgattactataagaatacatttaatcgt
aattcaattaatgatgcaggagcgccgttaaaatcaacagttcattacggaagtaattat
aacaatgcattctggaacggatcacagatggtatacggagatggtgatggtgtaacattt
acttcattatctggtggaattgatgtaattggtcacgagttaacgcatgctgttacggaa
aatagttcaaatctaatttatcaaaatgaatcaggggctttaaatgaagcgatttctgat
atctttggtactttagtagaattctatgataaccgtaacccggattgggagattggtgaa
gatatttacacacctggtaaagcaggagacgcgcttcgctctatgagtgatcctacgaag
tatggtgatccagaccattattctaagcgttacactggttcaagtgataacggtggcgtt
catacaaacagcggcattattaataaacaagcttatttattagcaaatggcggtacgcat
tacggtgtaactgtaaatggtatcggcaaagataaattaggtgcgatttactaccgtgca
aatacacagtatttcacgcaatctactacatttagtcaagctcgtgctggtgcagtacaa
gctgcagcagacttatatggtgcaaattctgctgaagtagcagcagttaagcaatcattt
agtgctgttggtattaactaa

DBGET integrated database retrieval system