KEGG   Burkholderia thailandensis H0587: BTL_1946Help
Entry
BTL_1946          CDS       T03113                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
btz  Burkholderia thailandensis H0587
Pathway
btz00010  Glycolysis / Gluconeogenesis
btz00053  Ascorbate and aldarate metabolism
btz00071  Fatty acid degradation
btz00280  Valine, leucine and isoleucine degradation
btz00310  Lysine degradation
btz00330  Arginine and proline metabolism
btz00340  Histidine metabolism
btz00380  Tryptophan metabolism
btz00410  beta-Alanine metabolism
btz00561  Glycerolipid metabolism
btz00620  Pyruvate metabolism
btz00625  Chloroalkane and chloroalkene degradation
btz00903  Limonene and pinene degradation
btz01100  Metabolic pathways
btz01110  Biosynthesis of secondary metabolites
btz01120  Microbial metabolism in diverse environments
btz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:btz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTL_1946
   00053 Ascorbate and aldarate metabolism
    BTL_1946
   00620 Pyruvate metabolism
    BTL_1946
  Lipid metabolism
   00071 Fatty acid degradation
    BTL_1946
   00561 Glycerolipid metabolism
    BTL_1946
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BTL_1946
   00310 Lysine degradation
    BTL_1946
   00330 Arginine and proline metabolism
    BTL_1946
   00340 Histidine metabolism
    BTL_1946
   00380 Tryptophan metabolism
    BTL_1946
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BTL_1946
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BTL_1946
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BTL_1946
Enzymes [BR:btz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BTL_1946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh GT87 DUF2007 OmdA
Motif
Other DBs
NCBI-ProteinID: AHI65350
LinkDB All DBs
Position
1:2156625..2158061
Genome map
AA seq 478 aa AA seqDB search
MKTCEQFYIGGAWRPSTGKGTIDVIDSGTEAVIGRIPEGTAEDAKAAVAAARAAFDGWAA
TPPAERARYLHKITDNLKARSEELAQSITGEVGMPIKLSRAIQVGGPIYNWGAYAKLAET
FAFEEQVGNSLVVREPVGVVAAITPWNYPLNQITLKVAAALAAGCTVALKPSEIAPLNAF
ILAEAIHDAELPAGVFNLVCGYGPVVGEALASDPEVDMVSFTGSTRAGKRVAELAAAGVK
RVALELGGKSASVILDDADFAAAVKGTVSACYLNAGQTCSAHTRMLVPESRYEEARELAK
AAAESYVAGDPRDDATRLGALASSAQQKRVQDYIRRGLDEGAELVTGGLGMPEGIARGFF
VKPTVFGRVKPDATIAQEEIFGPVLSIITYRDEDDAVRIANDSPYGLGGAVWSGSDERAM
RIARRIRTGQVDINGGAWNMAAPFGGFKQSGIGRENGVYGLEEYLEYKSMQLRPKKGA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacctgcgaacagttctatatcggcggcgcgtggcgcccgagcacgggcaagggc
acgatcgacgtgatcgactcgggcaccgaggccgtgatcggccgcattcccgaaggcacc
gccgaagacgcgaaagcggccgtcgccgccgcgcgcgcggcgttcgacggctgggcggcg
acgccgcccgccgagcgcgctcgctatctgcacaagatcaccgacaacctgaaggcgcgc
agcgaggagctcgcgcaatcgatcacgggcgaagtcggcatgccgatcaagctgtcgcgc
gcgatccaggttggcggtccgatctataactggggcgcgtatgcgaagctcgccgagacg
ttcgcgttcgaggagcaggtcggcaattcgctcgtcgtgcgcgagcccgttggcgtcgtc
gcggcgatcacgccatggaactacccgctcaaccagatcacgctgaaggtcgccgccgca
ctcgcggcgggctgcacggtcgcgctgaagccgtccgagatcgcgccgctcaatgcgttc
atcctcgccgaggcgattcatgacgcggagctgcccgccggcgtgttcaatctcgtgtgc
ggctacgggcccgtcgtcggcgaggcgctcgcgagcgatccggaggtggacatggtgtcg
ttcaccggctcgacgcgcgcgggcaagcgcgtcgccgagctcgccgcggccggcgtgaag
cgcgtcgcgctcgaactgggcggcaagtcggcctcggtgattctcgacgacgccgacttc
gcggccgccgtgaagggcacggtgtccgcgtgctacctgaacgcgggccagacgtgctcc
gcacatacgcggatgctcgtgccggaatcgcgctatgaagaagcgcgcgagctcgcgaag
gccgcggcggaaagctatgtcgcgggcgatccgcgcgacgacgcgacgcggcttggcgcg
ctcgcgtcgtcggctcagcaaaagcgcgtgcaggattacatccggcgcggcctcgacgag
ggcgccgagctcgtcacgggcggcctcggcatgcccgaaggcatcgcgcgcggcttcttc
gtgaagccgaccgtgttcggccgcgtgaagcccgacgcgacgatcgcgcaggaagaaatc
ttcggtccggtgctgtcgatcatcacgtatcgcgacgaggacgacgcggtgaggatcgcg
aacgattcgccgtacggcctcggcggcgcggtgtggtcgggcagcgacgagcgcgcgatg
cgcatcgcgcgccgcattcgcacggggcaggtcgacatcaacggcggagcctggaacatg
gccgcgccgttcggcggtttcaaacagtcggggatcggtcgcgagaacggcgtgtacggg
ctcgaagaatatctcgaatacaaatcgatgcaattgcggccgaagaagggcgcgtga

DBGET integrated database retrieval system