KEGG   Burkholderia ubonensis: BW23_4919Help
Entry
BW23_4919         CDS       T03794                                 

Gene name
aepX
Definition
(GenBank) phosphoenolpyruvate mutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bub  Burkholderia ubonensis
Pathway
bub00440  Phosphonate and phosphinate metabolism
bub01100  Metabolic pathways
bub01120  Microbial metabolism in diverse environments
bub01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bub00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BW23_4919 (aepX)
Enzymes [BR:bub01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BW23_4919 (aepX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Motif
Other DBs
NCBI-ProteinID: AJX12115
LinkDB All DBs
Position
II:complement(1822538..1824226)
Genome map
AA seq 562 aa AA seqDB search
MNAREPNFTESRSARLRRMLVSSDLEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAREWSGRAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQAVAREIHENETLINVEDRVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAAIVLAASRGKGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKKHGVNDITVVGGYR
ADAIDTSGIKLVVNERHAQTGELASLACAAERLTGDTVISYGDLLFRSYILRDLAESEAE
FSVVVDSSLTQPTNQSVRDFALCSAADDRGLFGQKTYLQRVSSDVAEGTPHGRWIGLLNV
RGAGVERLKAMLATLQARADFDTLDIPTLLNELIAAGEKIEVQYVHGHWRGVNDLEDFRR
AGDFAHGQTPLSEPGAGNGGAQ
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacgcgaacccaacttcaccgaatcgcgcagcgcgcgcctgcgccgcatgctc
gtcagcagcgacctcgaattcctgatggaagcgcacaacggcctgtccgcgcggatcgtc
cgcgaggcgggcttcaaggggatctgggcgtccggcctcgcgatctccgcgcagttcggc
gtgcgcgacaacaacgaggcgagctggacccaggtcgtcgacgtgctcgaattcatggct
gacgcgagcgacctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccgcctcgtgaagaagctcgagcagcgcggcatcgccggcgtgtgcatcgaggac
aagcagttcccgaagaccaacagcttcatcgacggcgagcgccagccgctcgccgagatc
gacgagttctgcggcaagatcaaggccggcaaggattcgcagagcgacccggacttctcg
atcgtcgcgcgcgtcgaggcgctgatcgccggctgggggatggacgaggcgctgcgccgc
gcgaacgcgtatgcggaagccggcgcggacgcgatcctgatccacagcaagctgtcgcgc
ccggacgagatcctgcagttcgcgcgcgaatggagcggccgcgcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaaccacctgatccgcgcatcggcgtccgcgatgcaggccgtcgcgcgcgag
atccacgagaacgaaacgctgatcaacgtcgaagaccgcgtcgcgtcggtcaacgagatc
ttccgcctgcaggacgccgacgagtattcggcggccgagcgcatctacctgtcgtcgtcg
tcgcgcgcgtcgaacgccgcgatcgtgctcgccgcgagccgcggcaaggggctggaagcc
gtcaccgaggacaagcccaaggtgatgttgccggtcgccggcaagccgctgctgcgctgg
ctcgtcgacggcttcaagaagcacggcgtgaacgacatcaccgtggtgggcggctaccgc
gcagacgcgatcgacacgtcgggcatcaagctcgtcgtcaacgagcgccatgcgcagacg
ggcgagctcgcgtcgctcgcgtgcgcggccgagcgcctgaccggcgacaccgtgatctcg
tacggcgacctgctgttccgcagctacatcctgcgcgatctcgcggaaagcgaggccgag
ttcagcgtcgtcgtcgattcgtcgctgacgcagccgacgaaccagagcgtgcgcgacttc
gcgctctgctccgctgccgacgaccgcggcctgttcggccagaagacctatctgcagcgc
gtgtcgagcgatgtggccgaaggcacgccgcacggccgctggatcggcctgctgaacgtg
cgcggcgcaggtgtcgaacgtttgaaggcgatgctcgcgacgttgcaggcgcgcgccgat
ttcgacacgctcgacattcccacgctcctcaacgaactgatcgccgccggcgagaagatc
gaggtgcagtacgtgcacggccactggcgcggcgtcaacgatctcgaagatttccgccgc
gcgggcgacttcgcgcatggccagacgccgctgtccgaaccgggcgccggcaacggaggc
gcgcaatga

DBGET integrated database retrieval system