KEGG   Burkholderia sp. RPE67: BRPE67_ACDS15580Help
Entry
BRPE67_ACDS15580  CDS       T03604                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bue  Burkholderia sp. RPE67
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bue00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    BRPE67_ACDS15580
Enzymes [BR:bue01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BRPE67_ACDS15580
DNA repair and recombination proteins [BR:bue03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BRPE67_ACDS15580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:complement(1674003..1676726)
Genome map
AA seq 907 aa AA seqDB search
MAEKLDTYQRMRRFDKTPEPSGAAKRGGGARARKTATKTAKKSATRALSFVIQEHDARRL
HYDFRLELDGTLKSWAVPKGPSLDPSVKRLAVHVEDHPLDYGSFEGEIPEGNYGAGSVIV
WDRGTWAPQSGSVEEAAREYEKGKLKFVLDGEKLHGGWTLVKSHMRGSGDKEQWLLIKER
DDEARPEAEYDILLKKPGSVLSESLGARAKNGALIDRAERKAAAKKAPARRTAARKQSDG
HAHPDIVANRSAESLRTLSHEPAIEGAVKAKLPATFKPQLATLVDAAPPGEDWAYEIKFD
GYRMLARIETSGSKRDIRIYTRNGNDWSAKFSKQVKALEKLDIESGWLDGEAVVLDERGL
PDFQALQNAFDAGRPQDIVVYFFDVPYLNGYDLRHVPLVQRRAMLKALIEPVDDSVLRYS
QDFAFHADELLKSACDMALEGIIGKRIDSAYVPGRGNSWIKLKCRRRQEFVIGGYSEPSG
SRGQFGALLLGVYDKSGKLQYAGRVGTGFDQKMLVAVKKELDKRETPRMPFASEPQERSR
TPVHWVKPELVAECNFAEWTKERIVRQASFVSLRDDKPARQIVKEEPVAAKKVAAKKTAA
VKKAKASSAEVEGVKISHPDRVIDKSAGYTKLDVVEYYASVAKWMLPHLKDRPVSLVRAP
EDIGGELFFQKHSAKLAIPHITQHPDIDPGHPPLLTIESSKALVGTAQMGTIELHTWNAV
ASNIEKPDRMVFDLDPGEGVGWERMIEAAKLTKELLAELGLTSFCKTSGGKGFHVVVPLR
KHADWDEMKAFSQAVAQHMANALPKFFSAKMGMQNRKGKIFIDYLRNNRGSSTVAAFSLR
ARPGLGASMPLSWDELDDVTSGDQWNIGNAHERLDALKRDPWADYEKARQRLTAEMKKRL
GMNGERK
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaaactcgacacctatcagcggatgcggcgtttcgacaagacgccggaaccg
tccggcgcggcgaagcgcggcggcggcgcgcgcgcgcgaaagaccgcgacgaagaccgca
aaaaagtctgcaacgcgggccttgtccttcgtcatccaggaacacgatgcgcgccgcctg
cattacgacttccggctcgaactcgacggcacgctcaagtcatgggcggtgcccaaaggc
ccgagcctcgatccgtcggtgaagcgtcttgctgtgcatgtcgaggatcatccgctcgat
tacggttcgttcgaaggcgagattccggaaggcaactacggcgcgggcagcgtgatcgtg
tgggatcgcgggacctgggcgccgcagtcgggcagcgtggaggaagcggcgcgcgaatac
gagaagggcaagctcaagttcgtgctcgacggcgaaaagctgcatggcggctggacgctc
gtgaaaagccatatgcgcggcagtggcgacaaggagcagtggctgctcatcaaggaacgc
gacgacgaagcgcggcccgaagccgagtacgacatcctcctgaagaagccgggcagcgtg
ctttccgaatcgctcggcgcgcgcgcgaagaacggcgcgctcatcgaccgcgccgaacgc
aaggccgccgcgaagaaagcgcccgcgcgcaggacggcggcgcgcaaacaatcggacgga
cacgcgcacccggatatcgtcgcgaaccggagtgcggaatcgttgcgcaccttgtcgcac
gagcctgccatcgaaggcgcggtcaaggcgaaactgcccgcgacgttcaagccgcagctc
gcgacgctcgtcgatgccgcgccgcccggcgaagactgggcctacgaaatcaagttcgat
ggttatcgcatgctggcgcgcatcgaaacgagcggcagcaaacgcgacatccgcatctat
acgcgcaacggcaacgactggagcgcgaagttctcgaagcaggtgaaggcgctcgagaag
ctggatatcgaaagcggctggctcgacggcgaagccgtggtgctcgacgagcgcggcctg
ccggattttcaggcgctgcaaaacgccttcgatgcgggacggccgcaggacatcgtcgtg
tatttcttcgatgtgccgtatctgaacggctacgacctgcgtcacgtcccgctcgtgcag
cggcgcgcgatgctgaaggcgctgatcgagccggtcgacgactcagtgctgcgctattcg
caggacttcgcctttcatgcggacgagctgctcaagagcgcgtgcgacatggcgctcgaa
gggatcatcggcaagcgcatcgacagcgcgtatgtgccggggcgcggcaattcgtggatc
aagctcaagtgcagacgccgccaggagttcgtgatcggcggctattcggagccgtcgggc
agccgcgggcagttcggcgcgcttctgctcggcgtgtacgacaagagcggcaagctgcaa
tacgccgggcgcgtgggcaccggtttcgaccagaagatgctcgtcgcggtgaagaaggag
ctcgacaagcgcgagacgccgcgcatgccgtttgcgagcgagccgcaggaacgcagccgc
acgcccgtgcattgggtgaagcccgaactcgtggccgagtgcaatttcgcggaatggacc
aaggagcgcatcgtgcgacaagcatcgttcgtcagtctgcgtgacgataaacccgcgcgt
cagatcgtgaaggaagagccggtggcggcgaagaaagtggcggcgaaaaaaaccgcggcc
gtgaaaaaggccaaggcaagctcggccgaagtcgaaggcgtgaagatcagtcatcccgat
cgtgtgatcgataaatccgccgggtacaccaagctcgatgtcgtcgaatactacgcatcg
gtcgccaaatggatgctgccgcatctgaaggaccgtccggtgtcgctcgtgcgcgcgccc
gaggatatcggcggcgagctcttctttcagaagcacagcgcgaagctcgcgattccgcat
atcacgcagcatcccgatatcgatccgggacatccgccgctgctcacgatcgaatcgtcg
aaagcgctcgtcggcaccgcgcagatgggcacgatcgaactgcatacgtggaacgcggtg
gcatcgaacatcgagaagccggatcgcatggttttcgatctcgaccccggcgaaggcgtg
ggctgggaacgcatgatcgaggccgcgaagctcacgaaggaactgctcgcggaactcggc
ctcacgtcgttttgcaagacgagcggcggcaagggatttcatgtggtcgtgccgctcagg
aagcacgcggactgggacgagatgaaggcgttttcgcaggcggtcgcgcagcacatggcg
aacgcgctgcccaagttcttctcggcgaagatgggcatgcagaaccgcaagggcaagatc
ttcatcgactatctgcgcaacaaccgcggttcgagcacggtcgcggcattctcgctgcgc
gcgcgccctgggctcggcgcgtcgatgccgctatcgtgggacgagctcgatgacgtcacg
agcggcgatcaatggaatatcggcaacgcgcacgagcggctcgacgcattgaagcgcgat
ccgtgggcggattacgagaaggcgcgtcaaaggctcaccgcggagatgaagaagcggctc
ggcatgaacggcgagcgcaagtga

DBGET integrated database retrieval system