KEGG   Burkholderia sp. RPE67: BRPE67_DCDS12020Help
Entry
BRPE67_DCDS12020  CDS       T03604                                 

Definition
(GenBank) glutathione S-transferase-like protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bue  Burkholderia sp. RPE67
Pathway
bue00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bue00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BRPE67_DCDS12020
Enzymes [BR:bue01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BRPE67_DCDS12020
Transporters [BR:bue02000]
 Other Transporters
  Pores ion channels [TC:1]
   BRPE67_DCDS12020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_C GST_N_2 GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: BAO92357
UniProt: A0A060PEG1
LinkDB All DBs
Position
p1:complement(1294937..1295596)
Genome map
AA seq 219 aa AA seqDB search
MSLQLYAHPFSSYCQKVLVALYENGTPFEWRALTPETPQSMHELTEIWPMKRFPVLVDDG
TPVIESTVIIEYLGLHHPGPVRLVPDDPRAALETRWMDRFFDNYVSTPQQKIIFDAMRDP
KERDTRGVADARAMLDTSYAFLERKMATREWAAGDAFTLADCGAAPFLFYADWTHRIGDA
YPNVIAYRKRLLARPSFARAVDEARPYRPLFPLGAPERD
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgagcttgcaactctatgcgcacccgttttcatcttactgtcagaaagtcctcgtggcg
ttatacgagaacggcacgcccttcgaatggcgcgcgctcacgccagaaacgccgcagtcc
atgcacgaactcaccgaaatctggccgatgaagcgtttcccggtgctcgtcgacgacggc
acgccggtgatcgaatcgaccgtgatcatcgaatatctgggacttcatcatcccggcccg
gtgcgcctcgtgcccgacgacccgcgcgccgcgctcgaaacgcgctggatggaccgcttc
ttcgacaactatgtgtctacgccgcagcagaaaatcatcttcgacgccatgcgcgatccg
aaagagcgcgatacgcgcggcgtcgccgatgcccgcgcgatgctcgacacgtcctatgca
tttcttgagcgcaagatggccacgcgcgaatgggccgcgggcgacgccttcactctcgcc
gactgcggcgcggcgccgtttctcttctatgcggactggacgcaccgtatcggcgacgcg
tatccgaacgtgatcgcgtaccgcaagcgtttgctcgcgcggccttcgtttgcgcgcgcg
gtcgacgaggcgcggccgtatcggccgctgtttccgctcggcgcgccggagcgcgactga

DBGET integrated database retrieval system