KEGG   Burkholderia sp. CCGE1001: BC1001_1500Help
Entry
BC1001_1500       CDS       T01424                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BC1001_1500
Enzymes [BR:bug01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BC1001_1500
Transporters [BR:bug02000]
 Other Transporters
  Pores ion channels [TC:1]
   BC1001_1500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1:complement(1715856..1716593)
Genome map
AA seq 245 aa AA seqDB search
MSLELYYWDGLQGRGEFVRLALEEAGADYVEVARGEPSEGLGTGAMMAVMKSRDEPYPPF
APPFLKDGDLVISQTANILFYLGPRLNLAPSVESLRYVANGLQLTIADMVTEAHDTHHPL
ASSLYYEDQKDAARARAHDFIDNRIPKFMNYFERVLKQNPAGDGFMVGDSLTYVDLSMFQ
LIDGLLYAFPRALARFADHYPRLAALHAAVMKRPKIAAYLQSERRIEHNEACIFRHYPEL
DKAAA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgagcctggaactttactattgggacggtctgcaaggccgtggcgaatttgtgaggctg
gcactcgaagaagccggcgcggactatgtcgaagtggcgcgcggcgagccgtccgaaggt
ctcggcaccggcgcgatgatggcggtcatgaaaagccgcgacgaaccctacccgccgttc
gcgccgccgtttctgaaagacggcgacctggtgatctcgcaaacggcgaacatcctgttt
tatctcggcccgcgtctgaaccttgcgccctctgtggaaagcctgcgctacgtggcaaat
gggctgcagctcaccattgccgacatggtgaccgaggcgcacgacacgcatcacccgctg
gcatcgagcctctactacgaggatcagaaagacgccgcgagagcacgcgcccatgacttc
atcgacaaccggattccaaagttcatgaactatttcgagcgcgtgctgaaacagaatccg
gccggcgacggcttcatggtcggcgactcgctcacctacgtggacctctcgatgttccag
ctgatcgacggactgctttacgcctttccgcgcgcgctcgcgcgcttcgccgaccactat
ccgcggctcgccgccctgcatgccgcagtgatgaagcggccgaagatcgccgcttatctg
cagtcggagcgccgcatagaacataacgaggcgtgcatcttccggcactatcccgaactc
gacaaggcggcggcttga

DBGET integrated database retrieval system