KEGG   Burkholderia sp. RPE64: BRPE64_ACDS15350Help
Entry
BRPE64_ACDS15350  CDS       T02684                                 

Definition
(GenBank) glutathione S-transferase domain
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
buo  Burkholderia sp. RPE64
Pathway
buo00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:buo00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BRPE64_ACDS15350
Enzymes [BR:buo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BRPE64_ACDS15350
Transporters [BR:buo02000]
 Other Transporters
  Pores ion channels [TC:1]
   BRPE64_ACDS15350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-ProteinID: BAN23289
UniProt: R4WH35
LinkDB All DBs
Position
1:1584489..1585223
Genome map
AA seq 244 aa AA seqDB search
MAYELYYWDGLQGRGEFVRLALEDAAAEYVDVARESKKSGYGMDAMMKVLNSKSEPHIPF
APPFLKDGKLIVPHVANILLYLGPKLHLAPKDEGLRYVAHGLQLTIADFITEVHDTHHPL
ATDLYYEDQKDAAKIRTQSFLDKRVPKFMSYFERVLKQNPQGDTHMIGDKATYVDLSVFQ
IVDGLHYAFPRAMNKFGKLYPRVAALHDAVLQRPNIAAYVDSERRIPFNESGIFRHYPEL
DQDA
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgaactctattactgggacggattgcagggccgcggcgaattcgtccggctc
gcgctggaagatgcagccgcggaatatgtcgacgttgcgcgcgaatcgaagaaaagcggc
tatggcatggacgccatgatgaaagtgctcaacagcaagagcgagccgcatattccgttc
gcgccgccgttcctgaaggatggcaagctgatcgtgccgcatgtcgcgaatatcctgctg
taccttgggccgaagcttcatctcgcgccgaaagacgaaggcctgcgatacgtcgcgcac
ggcttgcagctgaccattgcggatttcatcaccgaagttcacgacacgcatcatccgctc
gcgaccgatctgtattacgaagatcagaaggacgccgcgaaaatccgcacgcagagtttt
ctcgacaagcgcgtgcccaagttcatgagttacttcgagcgcgtgctcaagcagaacccg
cagggcgacacgcacatgatcggcgacaaggccacgtacgtcgatctgtcggtctttcag
atcgtcgatggactgcattacgcctttccgcgcgccatgaacaagttcggcaagctgtat
ccgcgtgtggccgcgttgcacgatgccgtgctgcaacggccgaacatcgcggcttatgtc
gattcggagcggcgcattccgttcaacgaatccggcattttcaggcactatcccgaactc
gatcaggacgcgtga

DBGET integrated database retrieval system