KEGG   Burkholderia sp. HB1: AC233_04055Help
Entry
AC233_04055       CDS       T04094                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
buq  Burkholderia sp. HB1
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:buq00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AC233_04055
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AC233_04055
   00680 Methane metabolism
    AC233_04055
Enzymes [BR:buq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AC233_04055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:complement(939178..942405)
Genome map
AA seq 1075 aa AA seqDB search
MTSSGSARSARRNTASPNASTADVDASTASASSAADAHATQPAKAKRATTGAKPAKATKA
ATAANAAKAIKAEKTSVPVKAEKTVKTSKAGKANEAASAMKNGKANAKAKTKSKAEDNAA
NLQAVSSESIVIAAPKTNGRTRDDKDHPLFQDIRYLGRLLGDVLREQEGDAVFDVVETIR
QTAVRFRREDDNAAAQTLDKKLRSLSPEQTVSVVRAFSYFSHLANIAEDRHRNRRHRIHA
LAGSAPQPGSIAYALERLVEAGAAATPVLQQFFNNALIVPVLTAHPTEVQRKSILDAEHD
VARLLAERDQQLTDRERAHNETMLRARVTSLWQTRMLRDSRLTVADEIENALSYYRATFL
EEIPALYADVEEALKEHGLEARLPPFFQMGSWIGGDRDGNPNVTAETLEHAISRQAEVIF
EHYLEQVHKLGAELSVSNLLAGASDELKALAESSPDRSPHRTDEPYRRALIGMYTRLAAS
ARVRLGEGSVPLRSAGRGAAPIRATPYDDAAEFARDLHVLIDSLAEHHGAPLAAPRLAPL
ARAAEVFGFHLASIDLRQSSDIHEAVIAELFKRAGVHDDYAALEESEKLDVLLTELAQPR
PLRLPYADYSDLVKSELGVLEQARVTREKFGARAVRNYIISHTETVSDLVEVMLLQKETG
LLQGRLGDANDPAKAALMVIPLFETIPDLRNAPHIMRDLLALPGVDSIIEHQGNEQEVML
GYSDSNKDGGFLTSNWELYRAELALVSLFNERAITLRLFHGRGGTVGRGGGPTYQAILSQ
PPGTVDGQIRLTEQGEVIASKFGNPDIGRRNLETVVAATLEASLLPHGNAPAELPAFEQT
MQQLSDAAMASYRALVYETPGFKEYFFESTPISEIAELNIGSRPASRKLQDPKQRKIEDL
RAIPWGFSWGQCRLLLTGWYGFGSAVAAFLDGAPSDAERGRRLALLKKMHKSWPFFSTLL
SNMDMVLAKTDLAVASRYAALVSDKKLRKHVFERIVAEWERTSKVLSEITGKSERLAENP
LLARSIKNRFPYLDPLNHLQVELLKRHRSGDTNARVRRGIHLTINGIAAGLRNTG
NT seq 3228 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtcttccggatcggcgcgctccgcccgccgcaacactgcatcgcccaacgcttcc
actgccgacgtcgacgcgtcgactgcttccgcctcgtccgccgcggacgcacacgccacg
caaccggccaaagccaaacgcgcgacgactggcgctaagcctgcgaaagccacgaaggcc
gccaccgccgcgaacgccgccaaagccatcaaggccgagaaaacctcggtgcccgtcaaa
gcggaaaagaccgtcaagacatcgaaggctggcaaagcgaacgaggccgcctccgcgatg
aagaacggcaaagcgaacgcgaaggcgaagacgaagagcaaagccgaagacaacgcggcg
aacctgcaagccgtgtcctcggaaagcatcgtcatcgccgcgccgaaaaccaacggccgc
acgcgcgacgacaaggatcatccgctcttccaggacatccgctatctcggccgcctgctc
ggcgacgtgctgcgcgaacaggaaggcgacgcggtgttcgacgtcgtcgaaacgatccgg
cagacggccgtgcgttttcgtcgcgaggacgacaacgccgccgcgcaaacgctcgacaag
aaactgcgctcgctgagccccgagcaaacggtcagcgtggtgcgcgcgttcagctacttc
tcgcacctcgcgaatatcgccgaggaccgtcaccgcaatcgccgccatcgtattcacgcg
ctggcgggctcggcgccgcagccgggcagcatcgcttatgcgctggagcggctcgtcgaa
gcgggcgccgcggcaacgccggtgttgcagcagtttttcaacaacgcgctgatcgtgccc
gtgctcaccgcgcacccgactgaagtgcagcgcaagagcattctcgatgcggagcacgac
gtcgcgcgcctgctcgccgaacgcgaccagcagttgaccgaccgcgaacgcgcgcacaac
gaaacgatgctgcgcgcacgcgtcacgtcgctatggcaaacgcgcatgctgcgcgactcg
cggctgaccgtcgccgacgaaatcgaaaatgcgctgtcgtactaccgcgcgaccttcctc
gaggaaattcccgcgctctacgccgatgtcgaagaagcgctgaaggagcacggtctcgaa
gcgcgcctgccgccgttcttccagatgggtagctggatcggcggcgaccgcgacggcaat
ccgaacgtcacggccgaaacgctcgagcacgcgatctcgcgccaggccgaggtcatcttc
gaacactatctggagcaggtgcacaagctcggcgcggaattgtcggtgtcgaatctgctc
gccggcgcgagcgacgaactcaaagcgcttgcggaaagctcgccggatcgttcgccgcat
cgcacggacgagccgtatcggcgcgcgctgatcggcatgtacacgcggctcgcggcaagc
gcgcgcgtgcgtctcggcgaaggcagcgtgccgctgcgcagcgcgggacgcggcgcagcg
ccgattcgcgccacgccttatgacgacgccgccgaattcgcgcgcgacctgcatgtgctg
atcgattcgctcgccgagcatcacggtgcgccgctcgccgcgccgcgtctcgcgccgctg
gcgcgcgcggccgaagtgttcggcttccaccttgcgagcatcgacttgcgtcagagttcg
gacatccacgaagcagtgattgccgagctgttcaagcgcgcgggcgtccacgacgactac
gcggcgctcgaagaaagcgagaagctcgacgtgctgctcacggaactcgcgcagccgcgt
ccgttgcgcctgccttacgccgactactcggatctcgtgaaaagcgaactcggcgtgctg
gagcaagcccgcgtcacgcgcgagaaattcggcgcgcgcgcggtgcgcaactacatcatt
tcgcacacggagacggtcagcgatctcgtcgaagtgatgctgctgcaaaaagaaaccggc
ctgctgcaagggcggctcggtgacgcgaacgatccggccaaagcggcgctgatggtgatt
ccgctcttcgagacgattcccgacttgcgcaacgcgccgcacatcatgcgcgatctgctc
gcgctgccgggcgtcgattcgatcatcgaacatcagggcaacgagcaggaagtgatgctc
ggctattcggacagcaacaaggacggcggcttcctcacgtcgaactgggagttgtaccgc
gccgaactcgcgctcgtgtcgctcttcaacgaacgcgccatcacgctgcgccttttccac
ggacgcggcggcaccgtcggccgtggcggcggcccgacctatcaggcgattctgtcgcag
ccgcctggcaccgtcgacggccagatccgtttgaccgagcaaggcgaagtgatcgcgagc
aagttcggcaacccggacatcggccggcgcaatctggaaacggtggtggcggcgacgctc
gaagcgtcgctgctgccgcacggcaatgcgcccgccgaactgcctgcattcgagcaaacg
atgcagcagttgtccgacgcggcgatggcgtcgtatcgcgcgctcgtgtacgaaacgccc
ggcttcaaggaatatttcttcgagtcgacgccgatctcggagatcgcggagctgaacatc
ggcagccgtccggcgtcgcgcaaattgcaagacccgaagcaacgcaagatcgaagatttg
cgcgcgattccgtggggcttttcgtggggccaatgccggctactgctgacgggctggtac
ggtttcggcagcgcggtcgccgcgtttctcgacggcgcgccgagcgacgccgaacgtggg
cgccgtcttgcgctgctcaagaagatgcacaagagctggccgttcttctcgacgctgctg
tcgaacatggacatggtgctcgccaagaccgacctcgcggtggcctcgcgctacgcggcg
ctggtgtccgacaagaagctgcgcaagcatgtgttcgagcggatcgtcgcggaatgggag
cgcacctcgaaggtgttgtcggagatcaccggcaagagcgagcggctcgcggaaaatccg
ctgctcgcgcgctcgatcaagaaccgttttccgtatctcgatccgctcaatcacttgcag
gtggaattgctcaaacgccatcgctcgggcgataccaacgcgcgcgtgcggcgcgggatt
catttgacgatcaacgggattgcggcgggcctgcggaatacgggctga

DBGET integrated database retrieval system