KEGG   Burkholderia sp. HB1: AC233_14465Help
Entry
AC233_14465       CDS       T04094                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
buq  Burkholderia sp. HB1
Brite
Enzymes [BR:buq01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AC233_14465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:complement(3319591..3320169)
Genome map
AA seq 192 aa AA seqDB search
MEHTLPPLPFAKNALAPHMSEETLEFHYGKHHQTYVTNLNNLIKGTEFENLSLEEIVKKS
SGGVFNNAAQVWNHTFFWNSLSPQGGGAPTGALADAINAKWGSFDKFKEEFAKTAIGTFG
SGWAWLVKKADGSLDLVSTSNAATPLTTDAKALITIDVWEHAYYIDYRNARPKFVEAYWN
IVNWEFASKNFA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggaacatacgctcccgccgctgccgttcgcgaaaaacgcactcgctccgcacatgtcg
gaagagacgctcgagtttcactacggcaagcaccaccagacctatgtgaccaacctgaac
aatctgatcaagggcacggagttcgagaatctgtcgctcgaagaaatcgtgaagaagtcg
tcgggcggcgtgttcaataacgcagctcaagtgtggaaccacactttcttctggaacagc
ctgtcgccgcaaggtggcggtgcaccgaccggcgcgctggccgacgcgatcaacgccaag
tggggctcgttcgacaagttcaaggaagagttcgcgaagaccgcaatcggcacgttcggc
tcgggctgggcatggctcgtgaagaaggcagacggttcgctcgacctcgtgtcgacgagc
aacgctgcgacgccgctgaccacggacgccaaagcgctgatcacgatcgacgtgtgggaa
cacgcgtattacatcgactatcgcaacgcacgtccgaagtttgtcgaggcttactggaac
atcgtcaactgggaattcgcgtcgaagaacttcgcgtga

DBGET integrated database retrieval system