KEGG   Burkholderia lata: Bcep18194_B2137Help
Entry
Bcep18194_B2137   CDS       T00286                                 

Definition
(GenBank) Glutathione S-transferase-like protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bur  Burkholderia lata
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Bcep18194_B2137
Enzymes [BR:bur01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Bcep18194_B2137
Transporters [BR:bur02000]
 Other Transporters
  Pores ion channels [TC:1]
   Bcep18194_B2137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:2451135..2451860
Genome map
AA seq 241 aa AA seqDB search
MRYELYYWPEIQGRGEYVRLALEAAEADYVDVARESGRGMGVPAMMRMMDSTKAECVPFA
PPFLKAGDVVIGQTANILLFLGARLGLAPGDEAGRLWVHQLQLTVADFVTEIHDTHHPIA
SGLYYEDQQAEAAERAADFLENRLPKFLGYFERVLDQNPHKSGYLAGNALSYADLSMFQL
IEGLRYAFPKAMKRAERKIAALVALHDRVALHPAVALYLESERRIPFNDMGIFRHYPELD
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgcgatacgaactgtattactggcccgagatccagggccggggcgagtatgtgcggctc
gcgctcgaagcggccgaagccgactatgtcgacgtcgcgcgcgaatcggggcgcggcatg
ggcgtgccggcgatgatgcgcatgatggacagcacgaaggccgaatgcgtgccgttcgcg
ccgccgttcctgaaagccggcgacgtcgtcatcgggcagaccgcgaacatcctgctgttt
ctcggcgcgcggctggggctcgcgcccggcgacgaagccggccggctgtgggtgcaccag
ttgcagttgaccgtcgccgatttcgtcaccgagatccacgacacgcaccatccgatcgca
agcggcctctactacgaggatcagcaggcggaagccgccgaacgcgcggccgattttctg
gaaaaccggttgccgaaattcctcggctacttcgagcgcgtactcgaccagaatccgcac
aagagcggttacctcgccggcaacgcactcagctatgcggacctgtcgatgttccagttg
atcgagggcctgcgttacgcgtttccgaaagcgatgaagcgtgcggagcggaagatcgcg
gcactcgtcgcgctgcacgaccgcgtcgcactgcatccggctgtcgcgctctatctcgag
tcggaacgccgtatcccgttcaacgacatgggcatcttccggcactatccggagctggac
aagtag

DBGET integrated database retrieval system