KEGG   Burkholderia lata: Bcep18194_C7411Help
Entry
Bcep18194_C7411   CDS       T00286                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3:1023222..1024985
Genome map
AA seq 587 aa AA seqDB search
MTKCASTIHRLIESLEDVAGAMHRMTFVDDAGNEASITYRRFAEEVFRQAGALRELDVRE
NDLVMLALPASVEHAAAMMACVMTGALPCTVPVPARRATTGRQVIDVACELYRPRLVIAA
DAQSAAWRDDAFPASSTRVVDLDTLSIVADAGARALISGKHGRDPHHVQLTSGSTSHPKA
AVLSHENVIANVLGIGGSVRFDLAAGDGTASWLPLYHDMGLLTLLSNMHYRAPLLMMQPN
SFIRNPLGWLKRIASARATTTSVPTFALRYCVRRFNAAAMEGVDLSACRNIFIGGERVDD
ATLRDFTATFEPYGLAASALQPCYGMAESTLAVSMHRAWHEGTVDGAPYVIADTLDRRAL
IERRDAQPAAANDGADTDTETVLAMGTPIEGMAFRILDDGDHPLANRAVGEVAIRGTSVM
LGYLNPDDGSIAAPLTADGWFRTGDIGYVADGQLHILGRKKEVIIIRGSNYFPHEIEEAL
ASHRTLRKSTCIAFGLPDPETGTERLVVAIEARPVDATPQTRAECQQLLASRIGFAAQDL
CFVEPGSLPRTTSGKLQRLKCRDLYANGALSVIHATAAAEAGQGAYA
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaagtgcgcatccaccattcatcgcctgatcgaatcgctcgaggacgtcgcgggc
gccatgcatcgcatgacgttcgtcgacgacgccggcaacgaggcgagcatcacgtaccgg
cgcttcgcggaagaagtgtttcgccaggccggcgcgctgcgcgaactcgatgtgcgcgag
aacgacctggtgatgctggccttgcccgcgtcggtcgagcacgcagccgcgatgatggcc
tgcgtgatgacgggcgcactgccctgcaccgtgcccgttcccgcgcgccgcgccaccacc
gggcgccaggtgatcgacgtcgcttgcgagctgtaccggccgcgcctcgtcatcgccgcg
gacgcgcaatcggccgcatggcgcgacgacgcgtttcccgcttcatccacgcgggtcgtc
gatctcgacacgctgtcgatcgtcgcggatgccggtgcacgtgcgctgatcagcgggaag
catggccgcgatccgcatcatgtccagctcacgtcgggctcgacatcgcatccgaaggcc
gcggtactcagccacgagaacgtgatcgcgaacgtgctcggcatcggcgggtcggtgcgg
ttcgacctcgcggccggcgacggcaccgcgtcgtggctgccgctctatcacgacatgggg
ctgctcacgctgctgtcgaacatgcattaccgcgcgccgctgctgatgatgcagccgaac
agctttatccggaatccgctcggctggttgaagcgcatcgcgtcggcacgcgcaacgacg
acgtcggtgccgaccttcgcgctgcgctattgcgtgcgccgtttcaatgccgccgcgatg
gaaggcgttgatctttccgcgtgccgcaacatcttcatcggcggcgaacgcgtggacgac
gcgacgctgcgcgacttcaccgcgacgttcgaaccgtacggcctcgcggcatcggcgctg
cagccgtgctacggaatggccgaatcgacgcttgcggtgtcgatgcatcgtgcgtggcac
gaaggcacggtcgatggcgcgccgtacgtgatcgccgatacgctcgaccggcgcgcgctg
atcgagcgccgcgacgcgcaaccggccgccgcgaacgacggcgccgacaccgacaccgaa
accgtgctcgcgatgggcacgccgatcgaaggcatggcgttccggatcctggacgacggc
gaccacccgctggcgaaccgcgcggtcggcgaagtcgcgatccgcggcacgtcggtgatg
ctcggctacctgaatcccgacgatggctcgatcgccgcaccgctgacggccgacggctgg
ttccgcaccggcgacatcggctacgtcgccgacggccagctccatatcctcgggcgcaag
aaggaagtcatcatcattcgcggcagcaactacttcccgcatgaaatcgaggaagcgctg
gcctcccatcgcacactgcgcaagagcacctgcatcgcgttcgggctgcccgaccccgag
accggcaccgagcggctggtcgtcgcgatcgaggcgcggccggtcgatgcgacgccgcag
acgcgcgccgagtgccagcagctgctcgcatcgcggatcggtttcgccgcgcaggatctg
tgcttcgtcgaacccggctcgctgccgcgcacgacgagcggcaagctgcaacgcctgaag
tgccgcgacctctatgcgaacggcgcgctgtccgtcatccacgcaacggccgccgccgaa
gccggccagggagcgtacgcatga

DBGET integrated database retrieval system