KEGG   Burkholderia lata: Bcep18194_C7485Help
Entry
Bcep18194_C7485   CDS       T00286                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00130  
betaine-aldehyde dehydrogenase [EC:1.2.1.8]
Organism
bur  Burkholderia lata
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Module
Betaine biosynthesis, choline => betaine
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcep18194_C7485
Enzymes [BR:bur01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.8  betaine-aldehyde dehydrogenase
     Bcep18194_C7485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3:1099275..1100753
Genome map
AA seq 492 aa AA seqDB search
MQANDRTIPLDHPDCFYIDGQWTPAPSAETFEVLDCSTERVAARVARADAAVAARAIDAA
RRAFDQGPWPRMTPAERAACLERIAQHLEAANDEFARGWSIESGILQRIAKPRIGQFLGA
AFRQYAAMADTYPFVEPHRSVTGHQAYAVKEAVGVVLAIVPWNGPAALIAYKVAPALLAG
CTVIIKPSPEAPTSAYLFAQICDEIGLPPGVVNVVTADREVSEAMVRNPSVDKITFTGST
AAGRSISEAAAGRIARVTLELGGKSAALVLDDYDLDAAAQVLGKSYFSYLTGQVCHSLTR
IIVPRAKHDTMVEALSEAAREMVLGDPFSDATTVGPLATARQRDTVEHHVAKGIAEGATL
AAGGARPRHLSRGFFFEPTVFANVDNRSTLAQQEIFGPVLSVIAADSEAHAIELANDSIF
GLNAVVFTSDAQHALQVARQLRTGSVGHNASRTDFSIGFGGFKQSGIGREGGVEGLNAFV
ESKTIVLDQPLA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcaaacgaccgaaccattccgctggaccatcccgactgcttctacatcgacggc
cagtggacgcccgctccttccgccgaaaccttcgaagtgctcgactgcagcacggagcgc
gtggcggcgcgggtggcgcgcgccgacgcggccgtcgccgcgcgcgcgatcgatgcggca
cgccgcgcgttcgaccagggaccgtggccgcgcatgacgccggccgagcgggccgcctgt
ctcgaacggatcgcgcaacacctcgaagcggcgaacgacgagttcgcgcgcggctggagc
atcgagtcgggcatcctccagcggatcgcgaagccgcgcatcggccagtttctcggcgcg
gcgtttcggcagtacgcggccatggccgacacctacccgttcgtcgagccgcaccgctcg
gtgaccgggcaccaggcgtatgccgtcaaggaagcggtgggcgtcgtcctcgcgatcgtg
ccgtggaacggcccggccgcgctgatcgcgtacaaggtcgcgcccgcgctgctcgcgggc
tgcacggtcatcatcaagccgtcgccggaagcgccgacttccgcgtacctgttcgcgcag
atctgcgacgagatcggcttgccgcccggtgtcgtcaacgtcgtgaccgccgatcgcgag
gtgtccgaggcgatggtgcgaaatccgtccgtcgacaagatcacgttcacgggttccacc
gcagccggccgcagcatcagcgaggccgcggccgggcggatcgcgcgcgtcacgctcgag
ctcggcggcaaatcggcggcgctcgtgctggacgattacgacctcgacgccgccgcgcag
gtgctcggcaagtcgtacttcagctacctgaccgggcaggtctgccacagcctgacgcgc
atcatcgtgccgcgcgcgaagcacgacacgatggtcgaagcattgagcgaggcggcacgt
gagatggtgctcggcgacccgttcagcgacgccacgacggtcggcccgctggccaccgcg
cggcagcgcgacacggtcgagcaccacgtggccaagggcatcgccgagggcgcgacgctc
gccgccggcggcgcacgtccgcgccatctgtcgcgcggcttctttttcgagccgacggtg
ttcgccaacgtcgacaaccggtcgaccctcgcgcagcaggaaatcttcgggccggtgctg
tccgtgatcgcggcggacagcgaagcgcatgcgatcgaactcgccaacgattcgatcttc
ggcctgaatgcggtggtgttcacctccgacgcccagcatgcgttacaggttgcgcggcaa
ctgcgtaccggcagcgtgggacacaatgcgtcgcgcacggacttctcgatcggtttcggg
ggcttcaagcaatcgggtatcgggcgcgagggtggcgtcgaaggactgaatgcgttcgtc
gaatcgaagacgatcgtgctcgatcagccgcttgcgtag

DBGET integrated database retrieval system