KEGG   Burkholderia pseudomallei TSV202: X994_137Help
Entry
X994_137          CDS       T03428                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
but  Burkholderia pseudomallei TSV202
Pathway
but00010  Glycolysis / Gluconeogenesis
but00020  Citrate cycle (TCA cycle)
but00620  Pyruvate metabolism
but01100  Metabolic pathways
but01110  Biosynthesis of secondary metabolites
but01120  Microbial metabolism in diverse environments
but01130  Biosynthesis of antibiotics
but01200  Carbon metabolism
Module
but_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:but00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    X994_137 (aceF)
   00020 Citrate cycle (TCA cycle)
    X994_137 (aceF)
   00620 Pyruvate metabolism
    X994_137 (aceF)
Enzymes [BR:but01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     X994_137 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N HlyD_D23 NQRA DEC-1_N
Motif
Other DBs
NCBI-ProteinID: AIV78770
LinkDB All DBs
Position
1:168033..169676
Genome map
AA seq 547 aa AA seqDB search
MSQAIEVKVPDIGDYKDVPVIEVLVKPGDAVEPEQSLVTLESDKATMDVPSPSAGTVKEV
KVKVGDAVSQGSLIVLLDGAQAAAQPAQANGAATSAAQPAAAPAAAPAPAAAAGGGTVDV
KVPDIGDYKDVPVIEIAVKIGDTVEKEQSLVTLESDKATMDVPSPAAGVVKDIKVKVGDA
VSEGSLIVVLEASGGAAASAPQAAAPAPAPAAPAPAPAPQAAPAAAPAPAQAPAPAASGE
YRASHASPSVRKFARELGVDVSRVTGTGPKSRITKDDVTAFVKGVMTGQRAAPGAAAAPA
GGGELNLLPWPKVDFSKFGPFEAKPLSRIKKISGANLHRNWVMIPHVTNNDEADITELEA
LRVQLNKEHEKAGVKFTMLAFVIKAVVAALKKFPTFNASLDGDNLVFKQYYHIGFAADTP
NGLVVPVIRDADKKGLVDIAKEMAELSKAAREGKLKPDQMQGGCFSISSLGGIGGTHFTP
IINAPEVAILGLSRGQMKPVWDGKQFVPRLTLPLSLSYDHRVIDGAEAARFNAYLGALLA
DFRRIIL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcgatcgaagtcaaggtgccggatatcggcgattacaaggacgtgcccgtc
atcgaagtgctcgtgaagccgggcgatgcggtcgagcccgagcagtcgctcgtcacgctc
gaatcggacaaggcgacgatggatgtgccgagcccgtcggcgggcacggtcaaggaagtg
aaggtgaaggtcggcgacgcggtgtcgcaaggctcgctgatcgtgctgctcgacggcgcg
caggcggcggcccagcccgcgcaggcgaacggcgccgcgacgagcgccgcgcagccggcg
gcggcgcccgctgccgcgcctgcgccggcggcggccgcgggcggcggcacggtcgacgtg
aaggtgccggacatcggcgactacaaggacgtgcccgtcatcgagatcgccgtgaagatc
ggcgacacggtcgagaaggagcagtcgctcgtcacgctcgaatcggacaaggcgacgatg
gacgtgccgagcccggctgcgggcgtcgtcaaggacatcaaggtgaaggtcggcgatgcg
gtgtcggaaggttcgctgatcgtcgtgctcgaagcgtcgggcggcgccgccgcgagcgcg
ccgcaggcggccgcgcccgcccccgcgccggccgcgccggctccggcgcccgcgccgcag
gccgcacctgcggctgcgccggcccccgcgcaggcaccggcacccgccgcgagcggcgag
taccgcgcgagccacgcgtcgccgtcggtgcgcaagttcgcgcgcgagctcggcgtcgac
gtgtcgcgcgtcacgggcacggggccgaagagccgcatcacgaaggacgacgtcaccgcg
ttcgtgaagggcgtgatgacggggcagcgcgcggcgcccggcgccgcggccgcgcccgcg
ggcggcggcgagctgaacctgctgccgtggccgaaggtcgacttctcgaagttcggcccg
ttcgaggcgaagccgctgtcgcgcatcaagaagatctcgggcgcgaacctgcatcgcaac
tgggtgatgatcccgcacgtcacgaacaacgacgaggcggacatcaccgagctcgaagcg
ctgcgcgtgcaactgaacaaggagcacgagaaggcgggcgtgaagttcacgatgctcgcg
ttcgtgatcaaggcggtcgtcgccgcgctgaagaagttcccgaccttcaacgcgagcctc
gacggcgacaacctcgtgttcaagcagtactaccacatcggtttcgccgccgacacgccg
aacggcctcgtcgtgccggtgatccgcgacgcggacaagaaggggctcgtcgacatcgcg
aaggaaatggccgagctgtcgaaggccgcgcgcgaaggcaagctcaagccggaccagatg
cagggcggctgcttctcgatctcgtcgctcggcgggatcggcggcacgcacttcacgccg
atcatcaatgcgccggaagtggcgatcctcgggctgtcgcgcggccagatgaagccggtg
tgggacggcaagcagtttgtgccgcgcctcacgctgccgctgtcgctgtcgtatgaccat
cgcgtgatcgatggcgcggaagccgcgcggttcaatgcgtatctcggcgcgttgcttgcc
gatttccgtcgcatcattctttga

DBGET integrated database retrieval system