KEGG   Burkholderia pseudomallei TSV202: X994_3126Help
Entry
X994_3126         CDS       T03428                                 

Definition
(GenBank) D-alanine--D-alanine ligase family protein
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
but  Burkholderia pseudomallei TSV202
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:but00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    X994_3126
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    X994_3126
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    X994_3126
Enzymes [BR:but01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     X994_3126
Peptidoglycan biosynthesis and degradation proteins [BR:but01011]
 Precursor biosynthesis
  Amino acid ligase
   X994_3126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
1:3578231..3579169
Genome map
AA seq 312 aa AA seqDB search
MSGIDPKRFGKVAVLLGGDSAEREVSLNSGRLVLQGLRDAGIDAHPFDPAQRPLAALKDE
GFVRAFNALHGGYGENGQIQGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGIPTPP
FETVMRGDDYAARAQDIVAKLGVPLFVKPASEGSSVAVEKVKSADALPAALEEAAKHDKI
VIVEKSIEGGGEYTACIAADLDLPLIRIVPAGEFYDYHAKYIANDTQYLIPCGLDAAKEA
EFKRIARRAFDVLGCTDWGRADFMLDAAGNPYFLEVNTAPGMTDHSLPPKAARAVGIGYS
ELVVKVLSLTLD
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggatcgatccgaaacgtttcggcaaggtggcggtgctgctcggcggggattcc
gccgagcgcgaggtatcgctgaactctggccggttggtgctgcagggcctgcgcgacgcg
ggcatcgacgcgcatccgttcgatccggcgcagcggccgctcgcggcgctcaaggacgaa
ggcttcgtgcgcgcgttcaacgcgctgcacggcggctacggcgagaacggccagatccag
ggcgcgctcgatttctacggcatccgctacacgggcagcggcgtgctcggctcggcgctc
gggctcgacaagttccgcacgaagctcgtctggcagcagacgggcattccgacgccgccg
ttcgagacggtgatgcgcggcgacgattatgcggcgcgcgcgcaggacatcgtcgcgaag
ctcggcgtgccgcttttcgtgaagccggcgagcgagggctcgagcgtcgcggtcgagaag
gtgaaaagcgccgatgcgttgcccgccgcactggaagaagcggcgaagcacgacaagatc
gtgatcgtcgagaagagcatcgaaggcggcggcgaatacaccgcgtgcatcgccgcggat
ctcgatctgccgctcatcaggatcgtgcccgcgggcgagttctacgactatcacgcgaag
tacatcgcgaacgacacgcaatacctgattccgtgcggcctcgacgcggcaaaggaagcc
gagttcaagcgcatcgcgcgccgcgcgttcgacgtgctcggctgcacggactggggccgc
gcggatttcatgctcgacgccgcgggcaacccgtatttcctcgaagtgaacaccgcgccg
gggatgaccgatcactcgctgccgccgaaggcggcgcgcgcggtgggcatcggctattcg
gagctggtggtgaaagtgctgtcgctcacgctcgattga

DBGET integrated database retrieval system