KEGG   Burkholderia sp. OLGA172: AYM40_21940Help
Entry
AYM40_21940       CDS       T05111                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
buz  Burkholderia sp. OLGA172
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:buz00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AYM40_21940
Enzymes [BR:buz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AYM40_21940
Transporters [BR:buz02000]
 Other Transporters
  Pores ion channels [TC:1]
   AYM40_21940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:353117..353770
Genome map
AA seq 217 aa AA seqDB search
MANTMLTISSKNYSSWSLRGWLLTKFSGLPFEEIVMPIDDPAARAELLLLSPSILVPCLF
HDGIKVWDTMAIAEYLNELKPEAALLPQDVRARAHCRSICGEMHSGFGSLRSALPMNLKA
HFPGFKVWARAQSDIDRIVTIWSECLKQYGGPFLFGERSAADAMYAPVVTRFVTYDVKLD
PEIVDYGQRIMALPEMQQWIADAQQEVEEIDELDVEF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggcgaataccatgctcaccattagcagcaagaactattcgtcgtggtcgctgcgcggc
tggctgctgaccaaattcagcggcctgcctttcgaagagatcgtgatgccgatcgacgac
cccgccgcgcgtgccgaattgctgctgctgtcgccatcaattctggtgccgtgtctcttt
cacgacggcatcaaggtctgggacaccatggcgattgccgagtatctgaacgagttgaaa
ccggaagcggcgctgttgccgcaggacgtccgcgcgcgagcacattgccgttcgatttgc
ggtgagatgcattcgggttttggttcgctgcgctcggcattgccgatgaatctgaaagcg
cattttccgggcttcaaggtgtgggcccgggcgcaatcggatatcgaccgcatcgtgacg
atctggagcgagtgcctgaagcagtacggcgggccgtttctgttcggcgagcgtagcgcg
gcggatgcgatgtacgcgccggtggtgacgcgtttcgtgacctacgacgtcaagctggat
ccggagatcgtcgactacgggcagcgcatcatggcgctgcctgaaatgcagcagtggatc
gcggacgcgcagcaggaagtggaagagatcgacgaactggatgtggagttttga

DBGET integrated database retrieval system