KEGG   Burkholderia sp. OLGA172: AYM40_34805Help
Entry
AYM40_34805       CDS       T05111                                 

Definition
(GenBank) chromosome partitioning protein ParA
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
buz  Burkholderia sp. OLGA172
Pathway
buz00010  Glycolysis / Gluconeogenesis
buz00520  Amino sugar and nucleotide sugar metabolism
buz01100  Metabolic pathways
buz01110  Biosynthesis of secondary metabolites
buz01120  Microbial metabolism in diverse environments
buz01130  Biosynthesis of antibiotics
buz01200  Carbon metabolism
Module
buz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
buz_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:buz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AYM40_34805
   00520 Amino sugar and nucleotide sugar metabolism
    AYM40_34805
Enzymes [BR:buz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     AYM40_34805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Tex_YqgF Pan_kinase Hexokinase_1
Motif
Other DBs
NCBI-ProteinID: ANB77264
UniProt: A0A160FVR9
LinkDB All DBs
Position
2:complement(3340613..3341413)
Genome map
AA seq 266 aa AA seqDB search
MATRKTTVKSSAERILAIDVGGTGLKAAIIDAGGQMKTERLRVPTPHPCTPDQLVDALVK
LVEPLVEKERPTLMSIGFPGVVRNNRILTAPHFGVEGWHDIPLAESLAQRLGGLPVRMIN
DAEMQGFAAIEGHGLEFVLTLGTGAGTALFRDGELMPHLELAHHPVSKKGAAYDEYIGDA
AREKAGNKRWNRRVQKVIGILDSLVNFDKLWIGGGNAARLTFKLPANVATVSNDAGIEGG
ARLWHPKSLRETRQLPEANERTGRFT
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gtggccacacgtaagacgacagtaaaaagcagtgccgagcggattctggcgatcgatgtc
ggcggcacaggcctgaaagccgcgattatcgatgccggcggccagatgaaaaccgagcgt
ttgcgcgtgccgacgccgcatccgtgcacgccggatcaactggtggatgcgttggtgaag
ctggtcgagccgctcgtcgaaaaggagcggcccacgctgatgtcgatcggcttcccgggc
gtggtgcgcaacaatcgcattctgacggcgccgcactttggcgttgaaggctggcacgac
attccgttagcggagtcgctggcacaacgcctgggcggtctgccggtgcggatgatcaac
gatgccgagatgcagggctttgccgcgatcgaaggtcatgggctcgagttcgtgctgacg
cttggcacgggcgcgggcacggcgctgtttcgcgatggcgagttgatgcctcacctcgag
cttgctcatcatccggttagtaagaagggcgcggcgtacgacgagtacatcggcgacgcg
gcgcgcgaaaaggcgggaaataagcgctggaatcgccgggtccagaaggtgatcgggatt
ctcgattcgctggtgaacttcgacaagctgtggattggcggcggcaacgcggcgcggctg
acgttcaagttacccgcgaacgtcgcgaccgtatcgaacgatgcggggattgaaggcggc
gcgcggctgtggcatccgaagtcgctgcgcgagacgcggcagttgccggaggccaatgag
cggacgggccggttcacgtga

DBGET integrated database retrieval system