KEGG   Brevundimonas vesicularis: CEP68_10160Help
Entry
CEP68_10160       CDS       T04934                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  
enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bvc  Brevundimonas vesicularis
Pathway
Fatty acid biosynthesis
Biotin metabolism
Metabolic pathways
Biosynthesis of antibiotics
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bvc00001]
 Metabolism
  Lipid metabolism
   00061 Fatty acid biosynthesis
    CEP68_10160
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CEP68_10160
  Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    CEP68_10160
Enzymes [BR:bvc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CEP68_10160
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CEP68_10160
Lipid biosynthesis proteins [BR:bvc01004]
 Fatty acid synthase
  Component type
   CEP68_10160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1984525..1985346)
Genome map
AA seq 273 aa AA seqDB search
MATSEGWDMPTGDLMKGKKGLIMGVANSSSIAWGIASQLATQGAELAFTYLGESLERRVR
PLAESVGAKLLIPADVTDDASMDAAFAELEKTFGTIDFVVHSVAFANKDELKGSFVDNTT
RDSFLLAMNISAFSFVDVSKRAAKLMPNGGSLITLTYLGSERVIPNYNTMGVAKAALEAA
TRYIARDLGPKNIRVNAISAGAMRTLSLAGISGGRGLHSKSAQFSLIKEETSMEGVAGAA
LWLCSDLGRSTTGEVVHVDAGFHAVGLPEDIEG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggcgacttccgaaggctgggacatgccgaccggcgacctcatgaagggcaagaagggc
ctgatcatgggcgtggcgaactccagctccatcgcctggggcatcgcctcgcagctggcc
acccagggcgccgagctggccttcacctatctgggcgagagcctggagcgccgcgtgcgt
ccgctggcggaaagcgtcggcgcaaagctgctgatcccggccgacgtcaccgacgacgcc
tcgatggatgcggccttcgccgaactggaaaagaccttcggcacgatcgacttcgtcgtc
cattcggtggcgttcgccaacaaggacgagttgaagggcagcttcgtcgacaacaccacg
cgcgacagcttccttctggccatgaacatctcggcctttagcttcgtggacgtgtcaaag
cgcgcggccaagctgatgccgaacggcggcagcctgatcaccctcacctatctggggtcc
gagcgggtcattccaaactacaacaccatgggcgtcgccaaggccgcactggaagccgcg
acccgctatatcgcgcgtgacctgggtcccaagaacatccgcgtcaacgccatctcggcc
ggggccatgcgcaccctgtcgctggccggcatctcgggcgggcgcggcctgcactccaag
tcggcgcagttctcgctgatcaaggaagagacctcgatggagggcgtcgcgggcgcggcc
ctgtggctgtgttcggacctgggccgttcgaccacgggcgaagtcgtccacgtcgatgcc
ggcttccatgccgtgggcctgccggaagacatcgagggctga

DBGET integrated database retrieval system