KEGG   Beta vulgaris (sugar beet): 104902309Help
Entry
104902309         CDS       T03548                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bvg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104902309
   00051 Fructose and mannose metabolism
    104902309
   00052 Galactose metabolism
    104902309
   00500 Starch and sucrose metabolism
    104902309
   00520 Amino sugar and nucleotide sugar metabolism
    104902309
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    104902309
Enzymes [BR:bvg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     104902309
Membrane trafficking [BR:bvg04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    104902309
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
8
AA seq 498 aa AA seqDB search
MRKAAVGATVICAAAVCAAAAVVVRQRMKSSSKWARAMAILKELDEKCETPLGKLRQVAD
AMTVEMHAGLASEGGSKLKMLISYVDNLPTGDEHGLFYALDLGGTNFRVLRVKLGGKEKG
VVQQEFDEVSIPPELMVGTSEELFDYIAAALAKFVATEGEGLHPEPNRQRELGFTFSFPV
KQTSIASGTLIRWTKGFSIEDTVGEDVVAELTKAMKRKGVDMRVTALVNDTVGTLAGGRY
TKGNVIAAVILGTGTNAAYVERASAIPKWHGPLPRSGEMVINMEWGNFRSSHLPLTEYDI
ALDEESLNPGEQIYEKMISGMYLGEIVRRVLCKMAEEASFFGDTVPPKLKTPFILRTPDM
SAMHHDTSPDLKVVASKLKDVLGIPNTSLKVRKVIVDICDIIASRGACLSAAGILGIIKK
LGKDALKQGENQKSVIALDGGLFEHYAKFRECMEDSLKELLGDEIADTIVVEHSNDGSGI
GAALLAASHSQYLEEEES
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaggcagcggtgggtgcgacggttatatgtgcggcggcggtgtgtgcggcggcg
gcagtggtggtgcgtcaaaggatgaaaagttcaagtaagtgggctcgtgcaatggctata
cttaaggagcttgatgaaaagtgtgagacacctttgggtaaattaagacaagtggcagat
gctatgacagttgagatgcatgctggacttgcatcagagggtggttctaagcttaagatg
ttaatcagctatgttgataatcttcctactggggatgaacatggattgttctatgcatta
gaccttggtggcaccaactttcgagtactacgagtgaaattgggtggcaaagaaaaaggt
gttgttcaacaagaatttgacgaagtgtcaattccacccgagttgatggttgggacgtca
gaagaactgtttgattacatagctgctgcacttgctaaatttgttgcaacggaaggtgaa
ggtcttcatcctgaaccaaatagacagagagagctgggatttaccttctctttcccagtt
aaacagacatcaattgcatcagggactcttataaggtggaccaaaggcttcagcatagaa
gatacagttggtgaagacgtggtggccgaattgaccaaggccatgaaaagaaagggtgta
gatatgcgtgtgacagctttggtcaatgatacagttggaaccttagctggaggtaggtat
actaaaggaaatgtaattgctgctgtcatattgggtactggaacaaatgcagcttatgta
gaacgtgctagtgcaattcctaagtggcatggtcctttgcccagatcaggggagatggtt
attaacatggagtggggcaatttccgttcatcgcacttgcccttgacagaatatgatatt
gcactagatgaagaaagtttgaatcctggtgaacagatctatgagaaaatgatatctgga
atgtacttgggggagattgtgcgtagagtcttgtgtaagatggcagaagaggccagtttc
tttggtgatacagtcccaccaaaactgaaaactccattcatcttaaggacaccagacatg
tctgccatgcatcatgacacatcacctgatcttaaagttgtcgctagcaaactgaaggat
gtcttagggataccaaatacatcattgaaagtgagaaaggttatagttgacatatgtgac
attatcgcttctcgtggggcctgcctttctgcagccgggatcttgggcattattaagaaa
ctagggaaagacgcattgaagcaaggtgagaatcagaagtctgtgattgcattagatgga
gggttgtttgaacactacgccaagttccgagagtgcatggaggactctttgaaggaatta
ctaggtgatgaaatcgctgacaccatcgtagtcgagcactcaaatgatggatcaggcatc
ggggctgctctcctagcagcatcgcattctcagtatcttgaggaagaagaatcttga

DBGET integrated database retrieval system