KEGG   Beta vulgaris (sugar beet): 104906059Help
Entry
104906059         CDS       T03548                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg00630  Glyoxylate and dicarboxylate metabolism
bvg00710  Carbon fixation in photosynthetic organisms
bvg01100  Metabolic pathways
bvg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bvg00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    104906059
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    104906059
Enzymes [BR:bvg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     104906059
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 104906059
NCBI-ProteinID: XP_010693073
LinkDB All DBs
Position
2
AA seq 180 aa AA seqDB search
MASSVLSSTAVATVSRTPAQASMVAPFNGLKSTVAFPVTKKNDDITSLASNGGRVQCMQV
WPPLGLKKFETLSYLPPLTTEQLLAEVNYLLVKGWIPCLEFEVKDGFVYREHNKSPGYYD
GRYWTMWKLPMFGCTDPAQVVNEVEEVKKAYPDAFVRIIGFDNKRQVQCISFIAYKPSGY
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctcagttctctcctccaccgccgtcgccaccgttagccgcaccccggctcaa
gccagtatggtggctcctttcaatgggttgaagtcaaccgtagccttccccgtcaccaag
aagaacgatgacattacctcccttgctagcaacggtggacgagtccaatgcatgcaggta
tggccaccacttggcttgaagaagttcgagaccctctcttaccttccacctctcaccaca
gagcaattgctggccgaagtcaactaccttctagtcaagggatggattccttgcttagaa
tttgaagtcaaagacggatttgtgtaccgtgagcacaacaaatcgccaggatactatgat
ggtcgctactggactatgtggaagttgcctatgttcgggtgcactgacccagctcaggtg
gtgaatgaggttgaggaggtcaagaaggcttaccctgatgcttttgttaggatcattggg
ttcgacaacaaacgtcaagtgcaatgcattagtttcattgcctacaagccttcaggctac
taa

DBGET integrated database retrieval system