KEGG   Beta vulgaris (sugar beet): 104907436Help
Entry
104907436         CDS       T03548                                 

Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH1
  KO
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:bvg00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    104907436
Enzymes [BR:bvg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     104907436
Chromosome [BR:bvg03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     104907436
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
4
AA seq 706 aa AA seqDB search
MDGVSGPSTQAQPSSLDKSRVLDVKPLRTLVPMFPNPPQAPPFVCSSPFGPFPSGFTPFY
PFSMGPPGSEARHGEGSGAGTGTGAGAYSTPAAAVPLRSFGTPQMGTHFSNGGGGGGDTE
SSMDINFGEGGGGSTVSGRKKRAATRSQPDAAAKRKERKAANAAASGEARKPNLANVVGL
PQPQREDGSREVVNFVIMKFDGVRRRLSQLEDSKEASTGLIKRADLKAGNILMTAGFRTN
SKKRIGAVPGVEIGDIFFFRMEMCVLGLHAPSMAGIDYMTVKTDMEDEPLAVSIVSSGGY
DDDAEDQDVLVYTGQGGGNYSNSGKQASDQKLERGNLALEKSARRGNQIRVIRGIRDTSN
PSLKIYVYDGLYTIQDSWIDKAKSGANLFKYRMVRLAGQSPAFGVWQSVLKWKESVSSRP
GLILPDLTSGAESLPVSLVNDFDSEKGPPYFTYLRSVKYTKSLNLSEPTYGCNCHSACAA
GDLNCSCIRKNGGDFPYTTNGVFVSRKPLVYECGPSCPCFPNCKNRVSQSGLKVRLEVFK
TKDKGWGLRSWDAIRSGIFICEFAGEVIDKAKYDRDESSDSSDYVFDTSRAYDKSFKWNY
DPPLVGEEVAAGGEWNEDYDIPTPLVISAKDSGNVARFMNHSCSPTVFWQPIVYENNGES
LIHIAFFAMRHIPPMTELTYDYGISQSESRRKRCLCGSPKCKGYFG
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggatggtgtttcgggtccgagcacgcaagcgcaaccgtcttcattggacaaatcaagg
gttttagatgtgaaacctttgagaactttggtacccatgtttccaaacccaccccaagct
cccccttttgtttgttcatctccatttggtccattcccatctgggttcactcccttttac
ccctttagcatgggcccgcccggttccgaggcccgacacggagagggttcgggtgccggc
accggtactggtgcgggtgcttattcaactcctgctgctgctgtacctctgcgttccttt
gggacgcctcaaatgggtacacatttctcgaatggaggcggaggcggtggcgataccgag
tcttcgatggacattaatttcggagagggtggtgggggaagtaccgtctctgggaggaag
aaacgggcagcgacacgcagtcagccggatgccgcggcgaagaggaaggaaaggaaggct
gcgaatgctgctgcttcaggggaagcaaggaaaccgaatttggcgaatgtggttggattg
cctcaaccacaaagggaagatggtagtagggaagttgttaattttgttataatgaagttt
gatggggttcgaaggcggttaagtcagctggaggactcgaaggaagcgtctaccgggttg
atcaagcgtgctgatttgaaagcaggtaacattttgatgactgctgggtttaggactaat
agtaagaagagaataggtgcagttcctggtgttgagattggtgatatattcttttttcga
atggagatgtgtgttttagggttgcatgcaccttctatggctggaattgattatatgact
gttaaaactgatatggaagatgagccacttgctgttagtattgtgtcttcaggtgggtac
gatgacgacgctgaggatcaagatgttcttgtttatactggacaaggtggtggaaattat
agtaatagtggtaaacaagcctctgatcagaagcttgagaggggaaatcttgctttagag
aagagtgctcgccgtgggaatcagattagggttattaggggtataagagatacctcgaat
ccgtcacttaaaatttatgtttatgatggactttatactattcaggattcatggattgat
aaggccaaatctggtgccaatcttttcaagtataggatggttaggttagctggccaatct
ccagcttttggagtttggcaatctgttttgaaatggaaagaaagtgtctcatcgaggccg
ggactcattcttcctgaccttacttcaggtgctgaaagtcttcctgtttcccttgttaat
gatttcgatagcgaaaaggggcctccttactttacctatctacgctctgttaagtataca
aagtcactcaacctgtctgagccaacctatgggtgtaattgccatagtgcttgtgctgct
ggtgatcttaactgttcttgtattcgcaagaatggaggggatttcccttatactacaaat
ggtgtcttcgtgagcaggaaaccacttgtatatgaatgtggaccttcatgtccgtgcttt
cctaattgcaagaatagagtgtcacagagtggtctaaaggtgcgattggaagtttttaag
actaaggataagggttggggcttgcgctcttgggatgccattcgatctgggattttcatt
tgtgaatttgctggtgaagtgatagacaaagccaaatatgatagagatgaaagtagtgat
agtagtgattatgtctttgatactagtcgtgcttatgataaatccttcaaatggaactat
gatcctccattggtgggtgaggaagttgctgctgggggtgaatggaatgaggattatgac
atccccactccattggtaattagtgccaaagattctgggaacgtggctcgctttatgaac
catagttgttcccctactgttttctggcaacctattgtgtatgagaataatggtgaatcc
cttattcatattgctttctttgcgatgcgacacattcctcccatgactgagctcacttat
gattatggtatatcccagtcagaaagtaggaggaagcggtgcttatgtggttcaccgaaa
tgcaagggttatttcggttga

DBGET integrated database retrieval system