KEGG   Burkholderia vietnamiensis G4: Bcep1808_1474Help
Entry
Bcep1808_1474     CDS       T00493                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcep1808_1474
  Amino acid metabolism
   00310 Lysine degradation
    Bcep1808_1474
   00380 Tryptophan metabolism
    Bcep1808_1474
Enzymes [BR:bvi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     Bcep1808_1474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1:1585500..1588364
Genome map
AA seq 954 aa AA seqDB search
MSDVMKQFQLNSYLFGGNASYVEELYDAYLNNPASVPENWREYFDALQNVPATDGSNAND
VAHYPIVESFAERAKANAFIPRESGSNLATARKQVHVQSLISAYRFLGSQWANLDPLKRR
ERPAIPELEPAFYDFSEGDLDQTYSASNLYFGFDQASLRDIVKGLRDTYCGTIGAEYMYI
SDPEQKRWWQERLESTRATPAFSADKKKHILNRLTAAEGLERYLHTKYVGQKRFSLEGGE
SFIAAMDEVVQHAGKSGVQEIIIGMAHRGRLNVLVNTLGKMPADLFAEFEGKHVDDLPAG
DVKYHKGFSSDVSTEGGPVHLSLAFNPSHLEIVNPVVEGSAKARMDRRGDDDGLQVLPVQ
IHGDAAFAGQGVVMETLNLAQTRGYGTHGTLHIVINNQIGFTTSDPRDARSTLYCTDVVK
MIEAPVLHVNGDDPEAVVLAIQIAIDYRMQFHKDVVIDIVCFRKLGHNEQDTPAVTQPLM
YKKIAQHPGTRALYAEKLVQQGVITAEDADGYVKAYRKAMDDGHHTVDPVLSNYKSKYAV
DWVPFLNRKWTDAADTAVPLAELKRLGERITTVPENFKVHPLVERVINDRRNMARGDQPL
DWGMGEHLAFASLVASGYAVRLTGQDSGRGTFTHRHAVLHDQNRERWNDGTYVPLQNIAE
GQAKFTVIDSVLSEEAVLGFEYGYSTAEPNTLVLWEAQFGDFVNGAQVVIDQFISSGEVK
WGRVSGLTMLLPHGYEGQGPEHSSTRIERFLQLCADHNMQVVQPTTPAQIFHLLRRQMIR
LFRKPLIIATPKSLLRHKEAVSDLSELAKGSFQPVLGETDGGIDPKKVKRVLACSGRVYY
DLVAHRREAKANDVAIIRIEQLYPFAHKQFEAEMKKYEHATEVVWVQDEPQNQGPWFYVE
HHLKEGMKEGQKLAYSGRPASASPAVGYYAKHYEQQKALIEGAFGRLKSTSIAK
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtaatgaagcagtttcagctgaactcctatctgttcggcggcaatgcttcg
tacgttgaagaactgtacgatgcatatctcaacaatccggcgtcggtgccggaaaactgg
cgagagtatttcgacgcgctgcagaacgtgccggcaacggacggttcgaatgccaacgac
gtcgctcactacccgatcgtcgaatcgttcgccgagcgtgcgaaggccaatgccttcatc
ccgcgcgaaagcggcagcaatctggccaccgcgcgcaagcaggttcatgtccagtccctg
atcagcgcctatcgcttcctcggctcgcaatgggccaatctggatccgctgaagcgtcgc
gaacgtcccgccatccccgagctcgaacctgctttctacgacttctccgaaggcgacctc
gaccagacgtacagcgcaagcaatctgtacttcggtttcgaccaggcttcgctgcgcgac
atcgtcaagggcctgcgtgacacgtactgcggcacgatcggcgccgagtacatgtacatc
agcgatccggagcagaagcgctggtggcaggagcgcctcgaatcgacgcgcgcgacgccg
gcgttctcggccgacaagaagaagcacatcctgaatcgcctgacggccgccgaaggcctc
gagcgctacctgcacaccaagtacgtcggccagaagcgcttctcgctcgaaggcggcgag
agcttcatcgcggcgatggacgaagtggtccagcacgcgggcaagagcggcgtgcaggaa
atcatcatcggcatggcccaccgcggccgtctgaacgtgctggtcaacacgctgggcaag
atgccggccgacctgttcgccgaattcgaaggcaagcacgtcgacgacctgccggccggc
gacgtgaagtaccacaagggcttctcgtcggacgtgtcgacggaaggcggcccggtccac
ctgtcgctcgcattcaacccgtcgcacctcgaaatcgtgaacccggtggtcgaaggttcg
gcgaaggcgcggatggaccgtcgcggcgacgacgacggcctgcaggtgctgccggtgcag
atccacggcgacgcggcattcgcgggccagggcgtcgtgatggaaacgctgaacctcgcg
caaacgcgcggttacggcacgcacggcacgctgcacatcgtcatcaacaaccagatcggc
ttcacgacgtccgacccgcgcgacgcgcgctcgacgctgtactgtaccgacgtggtcaag
atgatcgaagcgccggtgctgcacgtgaacggcgacgatcctgaagccgtcgtgctcgcg
atccagatcgcgatcgactaccggatgcagttccacaaggatgtcgtgatcgacatcgtg
tgcttccgcaagctgggtcacaacgaacaggacacgccggcggtcacgcagccgctgatg
tacaagaagatcgcgcagcacccgggcacccgtgcgctgtacgccgagaagctggttcag
cagggcgtgatcacggcggaagacgcggacggctacgtgaaggcgtaccgcaaggcgatg
gacgacggccaccacaccgtcgatccggtcctgtcgaactacaagagcaagtacgcggtc
gactgggtgccgttcctgaaccgcaagtggacggacgcagccgatacggccgtgccgctc
gccgaactgaagcgcctgggcgaacgcatcaccacggtcccggaaaacttcaaggttcac
ccgctcgtcgagcgcgtgatcaacgaccgccgcaacatggcgcgcggcgaccagccgctc
gactggggcatgggcgaacacctcgcattcgcgtcgctcgtcgcatcgggctatgcagtg
cgcctgaccggccaggactcgggccgcggcacgttcacgcaccgtcacgcggtgctgcac
gaccagaaccgcgagcgctggaacgacggcacgtacgtgccgctgcagaacatcgccgaa
ggccaggcgaagttcacggtgatcgactcggtgctgtcggaagaggcggtgctgggcttc
gaatacggttactcgaccgccgagccgaacacgctcgtgctgtgggaagcgcagttcggc
gacttcgtcaacggcgcgcaggtcgtgatcgaccagttcatctcgtcgggcgaagtgaag
tggggccgcgtgtcgggcctgacgatgctgctgccgcacgggtacgaaggccagggcccg
gaacactcgtcgacccgaatcgagcgtttcctgcaactgtgcgcggatcacaacatgcag
gtcgttcagccgaccaccccggcgcagatcttccacctgctgcgtcgccagatgatccgc
ctgttccgcaagccgctgatcatcgctacgccgaagtcgctgctgcgccacaaggaagcg
gtgtcggatctgtccgagctcgcgaagggctcgttccagccggtgctgggcgaaaccgac
ggcggcatcgacccgaagaaggtcaagcgtgtgctggcatgctcgggccgcgtgtactac
gacctcgtcgcgcaccgtcgcgaagcgaaggcgaacgacgtcgcgatcatccgtatcgag
cagctgtatccgttcgcgcacaagcagttcgaagcggaaatgaagaagtacgagcacgcg
actgaagtggtctgggtgcaggacgagccgcagaaccagggcccctggttctacgtcgag
caccacctgaaggaaggcatgaaggaagggcagaagctggcatacagcggccgcccggct
tcggcctcgccggcagttggctactacgcgaagcactacgagcagcagaaggccctcatc
gaaggtgcattcggccgcctgaagagcacatcgatcgcgaaataa

DBGET integrated database retrieval system