KEGG   Burkholderia vietnamiensis G4: Bcep1808_5735Help
Entry
Bcep1808_5735     CDS       T00493                                 

Definition
(GenBank) ATP-dependent DNA ligase LigD phosphoesterase module / ATP-dependent DNA ligase LigD polymerase module
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Bcep1808_5735
Enzymes [BR:bvi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Bcep1808_5735
DNA repair and recombination proteins [BR:bvi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Bcep1808_5735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
3:320282..323263
Genome map
AA seq 993 aa AA seqDB search
MAGKLDPYRRKRHFDATPEPAGARRRAKPQPQPDGRAAPRRPLRFVIQEHHARRLHYDFR
LELDGTLKSWAVPKGPSFDPSVKRLAVHVEDHPVEYASFEGQIPAGHYGAGSVVVWDEGT
WTPDGGVAGARSGYRAGKLTFRLDGEKLHGGWALVRSGRQEGRQEQWLLIKERDEAARSA
DEFDVVGERPGSVHAGEGGPSSAAGGAGADSHDATARTGGGGKHATQTGKRAARSGERAA
RAAERADDRDRATARAHVRDGDRAAARDRAAASDPGAARVRTRTGDGDADRTPRRTRTPD
HASASDRDPSTVEGAVRAPLPERIAPQLATLVDAPPADADWRYELKFDGYRILARIAGKG
ARRHVKLMTREGRDWTAKLRAQRDALAALPVDDAWLDGEAVVLGANGLPDFQALQNAFGA
GQSDDVTLFVFDLPYLDGYDLRDAPLAARRALLEPLVADSDPTRLRFSPDLGDDVASLIA
SACDTGLEGLIGKRAESRYRGGRSAAWIKLKCRRRQEFVIGGYTEPSGSRHGFGALLLGV
HDAPPAGKRARAAAPLRYVGRVGTGFDARALDRLAALLRRHERDTTPFEPAPRERTRTRV
HWVEPTLVAECEFAEWTGDGIVRQAAFIALRDDKPATQIVREMPKHVETEGAMERQQSTP
DAGHERKRASRAADDTGKRKPNARASASARNAREDGDAELSGRVRITHPERVLDPASGTR
KIDLARYWQWVAPWLLPDLKGRPVSLVRAPGDITGELFFQKHAERREIPFVTQHPGLDPG
HGALLSLDSVDALLGAAQMGTIELHTWNAHASNIERPDRIVFDLDPDPALPWSAMIEAAQ
LVRGLLDELGLRSFCKTSGGKGLHVVVPITRHMGWDDVKAFSRALAQHVAGALPERFTAT
MGPRHRRGKIFIDYLRNGRGASTIAAYSVRARPGLGVSVPLHWDEVPDTTGGAQWTIDTL
HERLERLKRDPWEGYDDTRQRITAQMRARLDGA
NT seq 2982 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcaagctcgatccgtatcgccgcaaacgccatttcgacgcgacgcccgaaccc
gcgggtgcgcggcggcgcgcgaagccgcagccgcagcccgatgggcgcgcggccccgcgc
cggccgttgcgtttcgtgatccaggaacatcatgcgcggcggctgcactacgacttccgg
ctcgaactcgacggcacgctgaaatcctgggcggtgccgaaggggccgagcttcgatccg
tcggtgaagcgtctggccgtgcacgtcgaggatcatccggtcgaatacgcgtcgttcgaa
gggcagattccggccggccactacggcgcagggtcggtcgtcgtgtgggacgaaggcacg
tggacgcccgacggcggcgtcgcaggcgcgcgcagcggctatcgcgcgggcaagctgacg
ttccggctcgatggcgagaagctgcacggcggctgggcgctggtgcgcagcggacggcag
gagggacgccaggagcagtggctgctgatcaaggagcgcgacgaagcggcgcgcagcgcc
gatgaattcgacgtggtcggcgagcggccgggcagcgtgcacgccggtgagggcgggcca
tcgtcggcggcaggcggcgcgggcgcggactcgcacgatgcgacggcgcgcacgggtggc
ggcggcaagcacgccacgcaaactggcaagcgcgccgcgcgaagcggcgagcgcgcggca
cgagcggccgagcgcgccgatgaccgcgatcgcgccaccgcccgcgcgcacgttcgcgat
ggcgaccgcgccgcggcccgcgaccgtgctgccgcaagcgaccctggcgccgcccgcgtc
cgaactcgcaccggcgacggcgacgccgaccgcacccctcgccgtacgcgtactcccgac
cacgcatcggccagtgaccgcgatccctccaccgtcgaaggcgccgtgcgcgcgccgctg
cccgagcgcatcgcgccgcaactggcgacgctggtcgacgcgccgcccgccgacgccgac
tggcgctacgagctgaaattcgacggctaccggatcctcgcgcgcatcgccggcaagggc
gcgcgtcgccacgtgaagctgatgacgcgcgaaggccgcgactggaccgcgaagctgcgc
gcgcagcgcgatgcgctcgcggcgctgcccgtcgacgacgcgtggctcgacggcgaggcc
gtcgtgctcggcgcgaacggcctgcccgacttccaggcgttgcagaacgcgttcggcgcc
gggcagtcggacgacgtcacgctgttcgtcttcgacctgccgtatctcgacggttacgac
ctgcgcgatgcgccgctggccgcgcgccgcgcgctgctcgagccgctcgtcgccgacagc
gacccgacccggctgcgcttttcgcccgatctcggcgacgacgtcgcgtcgctgatcgcg
agcgcctgcgacaccggcctcgaagggctgatcggcaagcgggcggaatcgcgctatcgc
ggcggacgctcggcggcatggatcaagctcaaatgccggcgccggcaggaattcgtgatc
ggcggctacaccgagccgtcgggcagccgccacggcttcggcgcgctgctgctcggcgtg
cacgacgcgccgccggccggcaagcgcgcgcgcgcggccgcgccgctgcgctacgtcggc
cgcgtcggcaccggcttcgacgcgcgcgcgctcgaccggctcgccgcgctgctgcgccgg
cacgagcgcgacacgacgccgttcgagccggcgccgcgcgaacgcacgcgcacgcgcgtg
cactgggtcgagccgacgctcgtcgccgaatgcgaattcgcggaatggaccggcgacggc
atcgtgcggcaggccgcgttcatcgcgttgcgcgacgacaagccggcgacgcagatcgtc
cgcgaaatgccgaagcatgtggaaacggagggagcgatggagcgacagcagagcacgccc
gacgcgggccatgaacgcaagcgcgcgtcgcgcgccgccgacgatacgggcaagcgcaag
ccaaacgcgcgcgcgagcgcgtccgcgcgcaacgcacgtgaggacggcgacgcggagctg
tccggccgcgtgcgcatcacgcatcccgagcgcgtgctggacccggcgagcggcacgcgc
aagatcgacctcgcgcgctactggcaatgggtggcgccgtggctgctgcccgacctgaaa
gggcggcccgtgtcgctcgtgcgcgcaccgggcgacatcaccggcgagctgttcttccag
aagcacgccgagcgccgcgagattccgttcgtcacgcagcaccccgggctcgatcccggg
catggcgcgctgctgtcgctcgacagcgtcgatgcgctgctcggcgcggcccagatgggc
acgatcgaattgcatacgtggaacgcgcatgcatcgaacatcgagcggcccgatcgcatc
gtgttcgacctcgatcccgatccggcgctgccgtggagcgcgatgatcgaggccgcgcag
ctggtgcgcgggctgctcgacgagctcggcctgcgctcgttctgcaagacgagcggcggc
aaggggctgcacgtcgtcgtgccgatcacgcggcacatgggctgggacgacgtgaaggcg
ttctcgcgcgcgctcgcgcagcacgtcgcgggcgcgctgcccgagcgcttcaccgcgacg
atggggccgcggcaccggcgcggcaagatcttcatcgactacctgcgcaacggtcgcggc
gcgagcacgatcgccgcctactcggtgcgcgcacggccggggctgggcgtatcggtgccg
ctgcactgggacgaggtgcccgacacgacgggcggcgcgcagtggaccatcgacacgctg
cacgagcgcctcgagcgcttgaagcgcgacccgtgggaaggctacgacgacacgcgccag
cgcattaccgcgcagatgcgcgcgcggctcgacggggcgtga

DBGET integrated database retrieval system