KEGG   Bartonella vinsonii: BVwin_03630Help
Entry
BVwin_03630       CDS       T02470                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase, Fe-Mn family
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bvn  Bartonella vinsonii
Brite
Enzymes [BR:bvn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BVwin_03630 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(464066..464668)
Genome map
AA seq 200 aa AA seqDB search
MAFELAALPYDYDALSPYMSRETLEYHHDKHHLAYLTNTNNFVKELGLENESLEDIVKKS
FGKNIGLFNNAAQYYNHNHFWHWMKKGGGGQKLPEKLAKAVEADLGGYDRFRTNFIAAAT
AQFGSGWAWVTVKDGKLEIMKTPNGENPLVHDAQPILGIDVWEHSYYIDYRNARPKYIEA
FIDHLINWDYVLKLYEDCGL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattggccgcgttgccttacgattatgacgccctttcgccctatatgtca
cgtgaaacgcttgaatatcatcatgataagcatcacctcgcttatctgaccaatactaat
aattttgtaaaagagttaggcttagaaaatgaaagccttgaagatattgttaaaaaaagc
tttgggaaaaatattggtttgtttaataacgcagcgcaatattacaatcataaccatttt
tggcattggatgaaaaaaggtggtggtggtcaaaaacttcctgaaaaacttgcaaaagct
gttgaggctgatctgggtggctatgatagattccgcactaattttattgctgctgctact
gcccaatttggttctgggtgggcatgggttactgttaaagatggcaagcttgaaattatg
aaaacacctaatggtgaaaatcctttagttcatgatgctcaacctattctggggatcgat
gtatgggaacattcctattacattgattaccgcaatgcacgtccgaaatatatcgaagct
ttcatagaccatttaattaattgggattatgttttgaagctttatgaagattgtggactt
taa

DBGET integrated database retrieval system