KEGG   Bosea vaviloviae: BHK69_14105Help
Entry
BHK69_14105       CDS       T04483                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bvv  Bosea vaviloviae
Pathway
bvv00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bvv00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BHK69_14105
Enzymes [BR:bvv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BHK69_14105
Transporters [BR:bvv02000]
 Other Transporters
  Pores ion channels [TC:1]
   BHK69_14105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_C_2 GST_C GST_N_2 GST_N GST_C_3
Motif
Other DBs
NCBI-ProteinID: AOO81439
UniProt: A0A1D7U244
LinkDB All DBs
Position
3063824..3064477
Genome map
AA seq 217 aa AA seqDB search
MTLELFAHPFSSYCQKALIAFYENEVPFTYRMLEDAGVGEELASLWPMKRFPILRDDSRV
VLEASVVIEYLELHHPGPVKLIPADPDLVLEARMLDRFFDNYVMTPQGKFVHDALRPPES
RDPYGVEDARKMLDTSYAWLDQRMQGRSWAVGETFSLADCAAAPSLFYADWTYRIPAHFS
HLLAYRARLLQRPSFARAVEEARRFRHYFPLGAPDRD
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcgaactcttcgcccatccgttctcgtcatattgccagaaggcgctcatcgcc
ttctacgaaaacgaggtgccgttcacctaccggatgctggaagacgccggcgtgggcgag
gagctcgcatcgctatggccgatgaagcgcttcccgatcctgcgcgacgacagccgcgtc
gtgctggaggcctccgtcgtcatcgaatatctggagctgcatcatccagggccggtgaag
ctgatccccgcggatcccgacctcgtcctcgaggcgcgcatgctcgaccgcttcttcgac
aattacgtcatgacgccccagggcaagttcgtccacgacgcgctgcgcccgcccgaaagc
cgcgacccttatggcgtcgaggatgcgcgcaagatgctggacaccagctatgcctggctc
gaccagcgcatgcaggggcgcagctgggcggtgggcgagaccttcagcctcgccgactgc
gccgccgcgccgtcgctgttctatgccgactggacgtaccgaatccctgcgcatttcagc
catctcctggcctaccgcgcgcgcctgctgcagcggccgtccttcgcccgcgcggtggag
gaggcgcggcgcttccgccactacttcccgctcggcgccccggatcgggactag

DBGET integrated database retrieval system