KEGG   Bacillus mycoides KBAB4: BcerKBAB4_4729Help
Entry
BcerKBAB4_4729    CDS       T00642                                 

Definition
(GenBank) superoxide dismutase copper/zinc binding
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
bwe  Bacillus mycoides KBAB4
Brite
Enzymes [BR:bwe01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BcerKBAB4_4729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ABY45879
JGI: BcerKBAB44729
UniProt: A9VMX4
LinkDB All DBs
Position
complement(4711451..4711990)
Genome map
AA seq 179 aa AA seqDB search
MKRRLFFSCCLLFLMAGCDQGKPKEIDVKLHNASGDEVGTAKVVQQTSGVKITIKAEGFT
PGPHGIHVHEIGECKAPRFESSGNHFNPDNKKHGLLNPKGAENGDLPNVVADGSGKIKAE
IDAPHITLEEGKTTIHRKDGASIIITENADDGMTQPTGKSGGRIACGVIVKKVSDMKKK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagacggctttttttcagttgttgtttattatttctaatggcgggttgtgaccaa
gggaagccgaaagaaattgatgtgaaattacataatgcttcaggtgatgaagttgggact
gcaaaagtagttcagcaaacaagtggagtgaaaattacgattaaagcggaaggctttaca
ccaggaccacacgggatacatgtgcatgaaatcggagaatgtaaagcgccacgtttcgaa
tcatctgggaatcattttaatccggataataaaaaacatgggctcttgaatccgaagggt
gcagaaaatggtgatttaccgaacgtagttgcagacggttcgggaaagattaaagcagaa
atcgatgctccgcatataacgcttgaagaaggaaaaacgacgattcatagaaaagatgga
gcgtctattattattacagaaaacgctgatgatggtatgacgcaaccaacgggtaaatct
ggtggccgaattgcttgcggtgttatcgtaaaaaaagtgtcggatatgaagaaaaaatag

DBGET integrated database retrieval system