KEGG   Paraburkholderia xenovorans LB400: DR64_3988Help
Entry
DR64_3988         CDS       T03290                                 

Gene name
aldHT
Definition
(GenBank) aldehyde dehydrogenase, thermostable
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
bxb  Paraburkholderia xenovorans LB400
Pathway
bxb00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:bxb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DR64_3988 (aldHT)
Enzymes [BR:bxb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     DR64_3988 (aldHT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC RbcS
Motif
Other DBs
NCBI-ProteinID: AIP33470
UniProt: Q13XQ3
LinkDB All DBs
Position
1:4343224..4344681
Genome map
AA seq 485 aa AA seqDB search
MSESATVFKNLIAGEWTESVSGKTFANINPADTRDVVGQFQASVVADAQAAIQAASSAFA
QWRRTPVTARARIVNKAADWLESHADTFAQELTREEGKPLAQSRDEILRSAQVLRFYAVE
AQSFTGETFPSDDPEQHVYTQREPLGVVTVITPWNFPISIPARKIAPALMAGNTVIFKPS
SDAPLIGYRLAEAFAQAGIPAGVLNFITGRASDIGAAITESPVVRAISFTGSTAAGEHIH
RSVPITTRTQMELGGKNPLIVMDDADLDRAVDLAVKGGLSLSGQACTGTSRILVMESVRE
TFTAKLVERVKSLKIGSGVTPGMDLGPLANRKQLESVLGYVASGKEQSTHLIGGEQLTGE
GFEHGYYVTPAVFSDVPESARIYREEIFGPVLAITSVTGYDDAIAKANDTEYGLSAAIAT
SNPRYMHRFADEIEAGTVKINRTTTGNVINAPFGGLKRSSTSTFRESGRAGLEFYTQIKT
VYRGL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaatccgcaactgtattcaagaacctgatcgccggagagtggaccgagagcgtc
agcgggaagaccttcgcgaatatcaatccggccgatacgcgcgatgtcgtcggccagttt
caggcgtcggtggtcgcggatgcgcaggcggcgatccaggccgcgtcgtccgccttcgcg
caatggcgtcgcacgccggtcacggcgcgggccaggatcgtcaacaaggcggccgactgg
ctggagagtcacgcagataccttcgcacaggagttgacgcgcgaagagggcaagccgctc
gcgcaaagccgcgacgaaattctccggtccgcccaggtcctgcgtttttatgcggtcgag
gcgcagtcattcaccggcgagacgtttccgagcgacgatccggagcagcacgtgtacacg
cagcgcgagccgctgggcgtggtcacggtcatcacgccgtggaatttccccatctccatc
ccggcgcgcaagattgcgcccgcgctgatggccgggaacacggtgattttcaagccgtcg
tccgacgcgccgctgatcggctaccggttggccgaagcatttgcacaggcgggcattcct
gccggcgtgctcaacttcatcacgggccgcgcgtcggatatcggtgctgcgattacagag
tcgccggtcgtgcgtgccatctcgtttaccggctcgaccgccgcaggcgaacatattcac
cgctccgtgccgatcacgacgcgcacgcagatggaactcggcgggaagaatccgctgatc
gtgatggacgatgcggatctcgaccgcgccgtggatctcgcggttaaaggcgggttgtcg
ctgagcgggcaggcttgtaccggcaccagccgaatcctggtcatggagtcggtgcgcgaa
acattcacggcaaaactggtcgagcgggtaaagagcctcaagatcggcagcggcgttact
cccggtatggacctcggcccgcttgccaatcgcaagcagctcgaatcggtactcggatat
gttgcgtccggcaaggaacagtcgacgcatctgatcggaggcgagcagctgacgggcgag
ggcttcgagcacggctactacgtcacgcccgcggtgttcagcgacgttcccgagagcgcg
cgcatttatcgcgaggaaattttcggacccgtgctagccatcacgtccgtgacgggctac
gacgacgcgatcgcgaaggcgaacgatacggagtacggcctgtcggcggcgattgccact
tcgaatccacgctacatgcaccggtttgccgacgagatcgaggcggggaccgtcaagatc
aatcgcaccactaccggcaatgtgatcaatgcgccgtttggcggcctgaagcgatcgagc
acgtcaacgttccgcgaatcggggcgagccggactcgagttctacacgcagatcaagacc
gtctatcgcgggctgtga

DBGET integrated database retrieval system