KEGG   Paraburkholderia xenovorans LB400: DR64_5713Help
Entry
DR64_5713         CDS       T03290                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
bxb  Paraburkholderia xenovorans LB400
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bxb00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    DR64_5713 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    DR64_5713 (alr)
Enzymes [BR:bxb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     DR64_5713 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:bxb01011]
 Precursor biosynthesis
  Racemase
   DR64_5713 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:1436775..1437947
Genome map
AA seq 390 aa AA seqDB search
MSVPIIEPAADAQGVRLLRPSWAELDYGAVAANLAVAREQVGRATKIYFVCKGDGFGFGA
AKVARLAAQAGVDGFCVGSPEEGVTIRRAGIDRDILLFASTLPEDAAQVAALGLTVTIQS
RESLHAFINAGVAVDAFLEIDPGFGRFGFLPSQWQAAFAALRDQSTVRLKGVYTHLSSPE
SEDVTRQQAGVFDAALADARAAGFDNLTTMLASSRVMLAHPHLAYQAVDPGRLLYGALDA
DWMARAPLRPMLRAVRGRIIHVQEHPAGATLGIGYAEPIRLERGVRIGVVPIGFWDGLNH
VPPLGRVLVHGQPARILGRRSFQHTVIDITEIAAARTGSVVTLLGQDGDQSITIDEMAET
LRLPVMELIPRLARSLPHVEVKTADPAGNN
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttccgatcatcgaacccgccgccgatgcgcaaggtgtgcgcttgctgcgtccc
agttgggccgaactcgactatggcgccgtcgcggcgaatctggcggtcgcgcgcgaacag
gtgggacgcgccacgaaaatctacttcgtctgcaagggcgacggattcggctttggcgcc
gcgaaggttgcgcggctggcggcgcaagcgggtgtcgatggcttttgcgtcggcagtccg
gaagagggcgttacgattcgccgtgcgggtatcgaccgcgacatactgctgtttgcttcg
accctgccggaagatgcagcgcaggtcgcggcgttggggctcacggtgacgatccagagt
cgggaaagcctgcatgcgttcatcaacgcaggcgtggcggtggatgcgttcctggagatc
gatccgggcttcgggcgcttcggctttctgccgtcgcaatggcaagccgcgttcgcggcg
ctgcgcgatcagtcgaccgtgcggctcaaaggcgtgtacacgcatctgagctcgccggag
agcgaagacgtgacgcgccagcaggccggcgtgttcgatgcggcgctggccgacgcgcgc
gccgcgggcttcgataacctaacgacgatgctggcaagctcgcgggtcatgctcgcgcat
ccgcatctggcgtatcaggcagtcgatcccgggcggcttctatacggtgcgctcgacgcg
gactggatggcccgcgcgccgttgcggcccatgttgcgggccgtgcgtgggcgcatcatt
cacgttcaggagcacccggccggagccacgctcgggattggctatgcggaaccgatccgg
ctcgaacggggcgtgcgtatcggtgtcgtgccgatcggtttctgggacgggttgaatcat
gtgccgccgctgggccgcgtgctggtgcacggacagccggcgcgcattcttgggcgccgc
tctttccagcataccgtgatcgatatcacggagattgccgcggcccggaccgggagcgtg
gtcacgttgctcggtcaggacggcgaccagtcgatcacgatcgacgagatggcggaaacg
ttgcggctgccggtcatggagttgattccccggctggcgagaagtctgccccacgtcgaa
gtgaaaacggcggatccggcgggcaacaactga

DBGET integrated database retrieval system