KEGG   Paraburkholderia xenovorans LB400: DR64_6156Help
Entry
DR64_6156         CDS       T03290                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bxb  Paraburkholderia xenovorans LB400
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bxb00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    DR64_6156 (gabT)
   00650 Butanoate metabolism
    DR64_6156 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DR64_6156 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DR64_6156 (gabT)
Enzymes [BR:bxb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     DR64_6156 (gabT)
Amino acid related enzymes [BR:bxb01007]
 Aminotransferase (transaminase)
  Class III
   DR64_6156 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2:complement(1951050..1952333)
Genome map
AA seq 427 aa AA seqDB search
MKNAELKSRKDAATPRGVGVMCDFYAERAENAELWDIEGRRFIDFAAGIAVCNTGHRHPK
IVAAIRDQLDHFTHTAYQIVPYASYVELAEKLNERAPGDYPKKTAFFTTGAEAVENAIKI
ARAATGRPGVIAFTGAFHGRTLMGMALTGKVAPYKIGFGPFPSDVFHAPFPNPLHGVTTA
DSLKAIEFLFKADIDPKRVAAIIFEPVQGEGGFYPAPAEFVRALRKLCNEHGILLIADEV
QTGFARTGKLFAMNHYDVVPDLMTVAKSLAGGMPLSGVIGRADVMDAAAPGGLGGTYAGN
PLAVAAAHAVLDIIDEEKLCERATLLGDRIKAKLIALQSDVPQIADVRGPGGMVAVEFCK
AGTTEPDAEFTKRVQSRALERGLLLLVCGVYSNVVRFLFPLTIQEAVFDEALAILEDVIK
DSVAITV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatgccgaactgaagagccgcaaagacgctgccacgccgcgcggcgtcggagtg
atgtgcgatttctacgccgagcgcgctgaaaacgcggagctgtgggatatcgagggccgc
cgtttcatcgacttcgcggccggtattgcagtgtgcaacacgggccaccgtcatccgaag
atcgtcgccgcgattcgcgaccagctcgatcacttcacccacacggcgtatcagatcgtg
ccgtacgcgtcgtatgtcgagctggctgagaagctcaacgagcgcgcgccgggcgactat
ccgaagaaaactgcgttcttcacgaccggcgccgaagccgtcgaaaacgcgatcaagatc
gcccgcgccgcgaccggccgccccggcgtgatcgccttcaccggcgctttccacggccgc
acgctgatgggcatggcgctgaccggcaaggtcgcgccgtacaagatcggctttggcccg
ttcccgtcggacgtgttccacgcgccgttccccaacccgctgcacggcgtgaccaccgcc
gattcgctgaaggccatcgaattcctgttcaaggccgacatcgatccgaaacgcgtggcc
gcgatcattttcgaaccggtgcagggcgaaggcggtttctatccggcgccggccgaattc
gtgcgcgccttgcgcaagctgtgcaatgagcacggcattctgctgatcgccgacgaagtc
cagacgggtttcgcacgcaccggcaagctgttcgccatgaatcactacgacgtcgtgccc
gatctgatgacggtcgccaagagtctcgccggcggcatgccgctgtcgggcgtgatcggc
cgcgcggatgtgatggacgcggccgcgcccggcggcctcggcggcacgtatgcgggcaat
cctctggcggtggccgccgcgcatgcggtgctcgatatcatcgacgaagagaagctgtgc
gaacgcgccacgctgctgggtgaccgcatcaaggccaaactgatcgcactgcaaagcgac
gtgccgcagatcgccgacgtgcgcggccccggcggcatggtcgcggtcgagttctgcaag
gcaggcaccaccgagccggatgcggagttcaccaaacgcgtgcagagccgcgcgctcgaa
cgcggcttgctgctgctggtgtgcggcgtctattcgaacgtggtgcgcttcctgttcccg
ctcacgattcaggaggcggtcttcgacgaagcgctggcgattctcgaagacgtgatcaag
gacagcgtcgccatcacggtttga

DBGET integrated database retrieval system