KEGG   Paraburkholderia xenovorans LB400: Bxe_A2328Help
Entry
Bxe_A2328         CDS       T00340                                 

Definition
(GenBank) ATP-dependent DNA ligase LigD phosphoesterase module / ATP-dependent DNA ligase LigD polymerase module
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Bxe_A2328
Enzymes [BR:bxe01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Bxe_A2328
DNA repair and recombination proteins [BR:bxe03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Bxe_A2328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1:2334491..2337496
Genome map
AA seq 1001 aa AA seqDB search
MNDRLDTYNRKRRFDDTPEPAGTRTSRKQGGRKTAGQASPEALSYVIQEHDARRLHYDFR
LELNGTLLSWAVPKGPSLDPSVKRLAVHVEDHPVEYGSFEGEIPLGNYGAGSVIVWDRGT
WEPLGGAAEAARAYAAGKLKFQLHGEKLHGGWTLVRSHMRGSGDKEQWLLIKERDDEARD
ESKYDILKKRPGSVLADSAAAVKGAKTAKTAAAKSTAKTASKAAVATATKATADPDSASL
AKRTGRNGAQKASSSRADPKRPDIVATRSAQSLRDLAASPSIEGAVPARLPATFKPQLAT
LVDGAPPGNEWSYEIKFDGYRVLVRIDRATKGSAVKVLTRAGNDWTAKFSKQVKAFEQLD
IESAWLDGEAVVLNQNGVPNFQALQNAFDSNRPQDIVIYLFDIPFLNGYDLRGVPLEQRR
AILRALLEDADDSVLRFSNNFEFSADDLLRSACDMALEGIIGKRRDSGYMSGRSSAWIKL
KCRRRQEFVIGGYSEPSGSRAAFGALLLGVYDGNGKLQYAGRVGTGFDAALLRSVKKELD
AHETRHMPFAAAPRERSRTPVHWVEPVLVAECNFAEWTSDGIVRQASFVSLRSDKPARQI
VKETPRQGADVQQQTDSVSNDAPTKRAARKTSASAATTSGEGKTRVAKSKTADAKDASTK
SRGVEASGAKGSAAKAAATKPTAATAKAAKATKTSAAKANTTSAPGEVAGVRVSHPDRVI
DRSTGTRKIDLVRYYESVADWMLPHLRDRPVSLVRAPEDIDGELFFQKHSQKLSIPNVTQ
HPGLDPGHPPLITVDTLKALVGAAQMGTVEFHTWNAVVSNIEKPDRMVFDLDPDASLGWE
RMIEAAQLTRSLLEELGLASFCKTSGGKGFHVVVPLAKQAGWDEVKDFSQAVAQHMAATL
PRYFSAKMGAQNRKQKIFVDYLRNNRGSSTVAAFSARARPGLGVSVPLAWDEVATTTGGA
QWTIENLHERLADLKSDPWADYAKTRQRITAAMKKRLDDAQ
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacagactcgacacctacaaccgcaaacgccgcttcgacgacacgccggaacct
gcgggcacgcgcacgagtcgcaagcagggcggccggaagacggccgggcaggcgtccccg
gaggcgctgtcgtacgtgattcaggagcacgacgcgcgtcgtttgcactacgacttccgg
ctcgaactgaacggcacgctcctgtcctgggcggtgccgaaagggccgagcctcgacccg
tcagtaaagcggctggcggtgcatgtcgaagaccatccggtcgaatacggttcgttcgaa
ggcgaaattccgctgggcaattacggcgcgggcagtgtgatcgtgtgggatcgcggcaca
tgggagccgctcggcggcgcggccgaggcggcgcgcgcttacgcggccggcaagctcaag
ttccagttgcacggcgagaagctgcacggcggctggacgctggtgcgcagccatatgcgc
ggcagcggcgacaaggaacagtggctgctcatcaaggaacgcgacgacgaagcgcgcgac
gaaagcaagtacgacattctgaagaagcgtccgggcagcgtgctcgccgatagcgctgcg
gcagtcaaaggcgcaaaaactgcaaagacggcggccgcgaagagcacagcaaaaactgca
agcaaagcggccgtggccacggccacgaaagccactgcggatcctgactcggcgtcgctc
gcaaaacgaaccggcaggaacggcgcgcagaaagcttcatccagccgcgcggacccgaag
cgacccgacatcgtcgccacgcgcagcgcgcaatcgctgcgcgacctcgccgcttcgccg
tcgatcgagggcgcggtgccggcacgcttgcccgcgaccttcaagccgcaactggcgacg
ctcgtcgacggcgcgcctcccggcaatgaatggtcgtacgaaatcaagttcgacggctat
cgtgtgctggtccgaatcgatagggcgaccaagggaagcgcggtcaaggtgctcacccgc
gccggcaacgactggaccgcgaagttcagcaaacaggtcaaggcgttcgaacaactcgac
atcgaaagtgcatggctcgacggcgaggccgtcgtgctgaaccagaacggcgtgccgaat
tttcaggcgctgcaaaacgcgttcgattcgaaccgcccgcaagacattgtgatttacctg
ttcgacataccgtttctgaacggctacgacttgcgcggcgtgccgctcgaacaacgccgc
gcgattctgcgcgcgttgctcgaagacgccgacgacagcgtgctgcgcttctcgaacaat
ttcgagttcagcgcggatgacctcctcaggagcgcgtgcgacatggcgctggaaggcatc
atcggcaagcggcgcgacagcggctatatgtcgggacgttcgtcggcgtggatcaaactg
aagtgccgccgacgccaggagttcgtgataggcggctactcggaaccgtccggcagccgc
gcggcgttcggtgcgctgctgctcggcgtctatgacggcaacggcaagttgcagtatgca
gggcgcgtgggcaccggtttcgacgcggcgctgctgcgctcggtgaagaaagaactcgat
gcgcacgagacccggcacatgccgttcgccgccgcgccgcgcgaacgcagccgcacgccg
gtgcattgggtcgaaccggtgctggtcgccgaatgcaatttcgcggaatggacgagcgac
ggcatcgtgcggcaggcgtcgttcgtgagtctgcgcagcgacaagccggcgcgccagatc
gtcaaggaaacacctcgacagggagccgacgtgcaacagcaaaccgattctgtgtctaac
gacgcgccgaccaaacgtgccgcgcgcaagacttccgccagtgcggcgacaacgtccggc
gaggggaaaactcgcgtggcgaaatcgaagactgcggatgcgaaagacgccagtacaaag
agccgtggagtagaggcaagcggtgcgaaaggcagcgctgcgaaagccgctgcaaccaaa
ccaacggcagcgacagccaaagcagcgaaagcgacgaaaacctcagccgcaaaagcaaac
accacctcagcccccggcgaagtcgccggcgtccgcgtctcccatcccgaccgcgtcatc
gacaggagcacgggcacgcgcaagatcgatctcgtgcggtactacgaatcggtggccgac
tggatgctgccgcatctgcgggaccgcccggtttcgctggtgcgcgcccccgaggacatc
gacggcgagctgtttttccagaagcacagccagaagctgtcgattccgaatgtcacccag
catccggggctcgatccggggcatccgccgctgattaccgtcgatacgctcaaggcgctg
gtcggcgccgcgcaaatgggcaccgtcgaatttcacacgtggaatgccgttgtgtcgaac
atcgaaaagccggaccgcatggtgttcgacctcgacccggatgcctcgctgggttgggag
cgcatgatcgaagccgcgcaattgacgcgttcgctgctcgaagaactcggtctcgcgtcg
ttctgcaagacgagcggcggcaagggatttcacgtggtcgtgccgctcgcgaagcaggcc
ggctgggacgaagtgaaggacttttctcaagccgtcgcgcagcacatggcggcgacgctg
cccaggtacttcagcgcgaagatgggcgcgcagaatcgcaagcagaaaattttcgtcgac
tacctgcgcaacaaccgcggatcgagcacggtcgccgcattttccgcgcgcgcgcggccg
ggcctgggcgtatcggtgccgctggcctgggacgaagtcgccaccacgacgggcggcgct
cagtggaccatcgagaatctgcacgaacgcctcgccgacctgaaaagcgacccgtgggcg
gactatgcgaaaacgcgccagcgcattaccgctgccatgaaaaaacgcctggacgacgcg
cagtaa

DBGET integrated database retrieval system