KEGG   Paraburkholderia xenovorans LB400: Bxe_A3350Help
Entry
Bxe_A3350         CDS       T00340                                 

Definition
(GenBank) Putative glutathione S-transferase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
bxe  Paraburkholderia xenovorans LB400
Brite
Enzymes [BR:bxe01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     Bxe_A3350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1:1232179..1232886
Genome map
AA seq 235 aa AA seqDB search
MTDLSAFPITKKWPARHPDRLQLYSLPTPNGVKVSIMLEETGLPYEPHLVRFDTNDQMTP
EFLSLNPNNKIPAIIDPDGPDGKPLPLFESGAILIYLADKSGRFIPQDAAGRYEAIQWVM
FQMGGIGPMFGQLGFFHKFAGKEYEDKRPRDRYIAESKRLLGVLDRQLEGRDWILGDTYS
IADIATFPWVRNLIGFYEAGDLVGIQDFPNVTRVLAAFVARPAVARGLEIPKRPS
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgactgatctatccgcttttccgatcacgaagaaatggcctgcccggcatccggaccgg
cttcagctgtactcgctgcccacgcccaatggcgtgaaggtgtcgatcatgctcgaagag
acgggtttgccgtacgagccgcatctcgtgcgtttcgatacgaatgatcagatgacgccg
gagtttctgtcgctcaatccgaacaacaagattccggcgatcatcgatccggatggcccg
gatggcaaaccgctgccgctattcgaatccggcgcgatcctgatctatctcgccgacaaa
agcggccggttcattccgcaggatgccgccggccgctacgaagcgatccagtgggtgatg
ttccagatgggcggtattgggccgatgttcggccagctgggtttctttcacaagtttgcc
ggtaaggaatacgaggacaagcgtccgcgcgaccgttatatcgccgaatcgaaaagactg
cttggcgtgctggatcgccaactcgaagggcgcgactggattctgggcgatacgtactcg
attgccgatatcgccaccttcccttgggtgcgcaatctgatcggcttttatgaggcgggc
gatctcgtcggcattcaggatttcccgaatgtcacgcgtgtgctggcggcgtttgtcgcg
cgccctgccgtggcgagggggctggagattccgaagcgtccgtcgtaa

DBGET integrated database retrieval system