KEGG   Bacillus xiamenensis: BK049_14215Help
Entry
BK049_14215       CDS       T04852                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bxi  Bacillus xiamenensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bxi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BK049_14215
   00030 Pentose phosphate pathway
    BK049_14215
   00051 Fructose and mannose metabolism
    BK049_14215
   00052 Galactose metabolism
    BK049_14215
  Energy metabolism
   00680 Methane metabolism
    BK049_14215
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BK049_14215
Enzymes [BR:bxi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BK049_14215
Protein phosphatases and associated proteins [BR:bxi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BK049_14215
Messenger RNA biogenesis [BR:bxi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BK049_14215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2790272..2791231
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHNVEVYGIYNGYSGLINGKIEKLEIGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIENLKKFGIEGLVVIGGDGSFMGAKKLTELGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVVEVMGRHAGDIALWS
GLAGGAESILIPEADYDMDEIIARLRRGHERGKKHSIIIVAEGVGSGVEFGKRIEEETSL
ETRVSVLGHIQRGGSPSAFDRVLASRLGAYAVELLLEGKGGRCVGIQSNELVHHDILEIL
DKKHTVDQNMYRLSQELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtataggagttttaacgagcggtggggattccccaggaatgaatgcagctgtg
cgcgcagttgtaagaaaagcaatttatcataatgttgaagtttatggtatttataatgga
tattcaggtctaattaacggtaaaattgagaaactcgaaataggttcggtaggcgatatc
attcatcgtggaggaacaaaactttacacggcaagatgtcctgaattcaagacagttgaa
ggccgtgaaaaagggattgaaaacttaaaaaaattcggtatcgaaggacttgttgtcatc
ggtggagatggctcattcatgggagcgaagaaattaacagagctcggttttccatgtgta
ggtgtcccgggcacgattgataacgatattccaggtactgatttcactattggctttgat
acggcacttaatacagtgattgatgccattgataaaattcgtgatacagccacatctcat
gaacgtacatacgtagttgaagtaatgggaagacatgctggagatattgccctttggtca
ggtcttgcgggcggagccgaatccattttgattcctgaggcagactatgacatggacgaa
attattgccaggttgagaagaggacatgagcgcggcaagaagcacagtatcatcatcgta
gcagaaggcgtaggcagcggtgttgaatttggtaagcgaattgaagaggagacaagcctt
gaaacgcgtgtatctgtcttagggcatattcagcgcggaggttctccaagtgcgtttgac
cgagtgctggcaagccgtttaggagcgtatgcagtagaacttcttcttgaaggaaaaggc
ggacgctgtgtaggcattcaaagcaatgaactcgttcaccacgatattttagaaatctta
gataaaaaacatacagtcgatcaaaatatgtaccgactttcacaagagctctctatataa

DBGET integrated database retrieval system