KEGG   Bacillus xiamenensis: BK049_17595Help
Entry
BK049_17595       CDS       T04852                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
bxi  Bacillus xiamenensis
Brite
Enzymes [BR:bxi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BK049_17595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AOZ90371
LinkDB All DBs
Position
3421112..3421690
Genome map
AA seq 192 aa AA seqDB search
MKMSMWTVMMCLVILASACHAPPKKETTEESHEVAAPKQAPVTASLINESGQKIGSIDIR
ESSSNGLDLHVKAKGLPPGAHGFHIHETGVCEAPDFETAGAHFNPTHREHGFDNPKGHHA
GDMPNLEVGADGQIDVVVNVPDVTLKGGANQLIDQHGRSFIIHAEADDYLSNPSGNSGKR
IACGAITKEMVK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgtccatgtggacggtcatgatgtgtttggtcattctcgcatcagcatgtcat
gcgccgccgaaaaaagaaacaacagaagagagtcacgaagttgcagcacctaaacaagcg
ccagtcaccgcttcattgattaatgaaagcgggcaaaaaataggaagcatcgacatacga
gaatcctcatcaaatggactggatttacatgtgaaagcaaaaggattaccgccaggagcc
cacggcttccatattcatgagacaggcgtatgtgaagcaccagattttgaaacggcgggt
gcgcattttaatcccacgcatagagaacacggcttcgacaacccaaaggggcatcatgcg
ggagatatgcctaatttagaggtaggagcagatggccagattgatgttgtcgtcaatgta
cctgatgtgacgttaaagggaggcgcaaatcaattaattgatcaacatggccgaagtttt
atcatccatgcagaagcagatgattacttaagtaacccgtctggaaattcagggaaacgc
atcgcttgcggagccatcacaaaagaaatggtaaaataa

DBGET integrated database retrieval system