KEGG   Blautia sp. YL58: A4V09_12235Help
Entry
A4V09_12235       CDS       T04458                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
byl  Blautia sp. YL58
Pathway
byl00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:byl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    A4V09_12235
Enzymes [BR:byl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     A4V09_12235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Cellulase LBP_M HTH_21
Motif
Other DBs
NCBI-ProteinID: ANU76468
UniProt: A0A1C7IBS6
LinkDB All DBs
Position
complement(2604132..2606144)
Genome map
AA seq 670 aa AA seqDB search
MDELLYGVAYYDEYMPYDRLEKDVAMMKKAGINLVRIAESTWSTLEPQDGVFDFYHIDRV
LDAMEEAGIHVIVGTPTYAIPAWMEKKHPDVMAVTKQGRGIYGARQIMDITNRHYLFYSE
RVIRKLMEHVKDRACVIGYQIDNETKYYGTAGERVQEAFTAYLKDKFRGDVEAMNREFGM
NYWSNALHSWEDFPDVRGTINGSLGCEFEKFQRGLVTEFLSWQAALVGEYKREDQFVTQN
FDFEWRNHSFGVQPEVNHFHVSKCLDVAGCDIYHPTQSKLTGKEIAFGGDLTRSLKQDNY
YVLETEAQGFTQWVPYDGQLRLQAFSHLAGGADCVEYWHWHSIHNSFETYWRGLLSHDFA
ENKTYGEAVVIGNEMKRLGSHLLHLKKENKAAIMVSNEALSGLKWFPIQGSLEQKKSYND
VVRWIYDALYEMNVECDFVSPEAENLEDYKMLILPALYCVPEETLVRIRRFTENGGCLLG
TFKTAYANENVKVYHDSQPHILSECFGILYNQFTYPEDTYLEGRLCSREEKEGAEVFMEC
IQTKGAETVLRYVHDNWGQYAAVTENTFGKGKAVYLGCMFSPKLLKKLLEELLKDCQIHP
NPGSCGFPVIVRGGRNQMGKQVYYFLNYSGEKQEAACPEGTWTELFSGETKRAGETLLLQ
KWNLLILEEQ
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggacgaattactctatggcgtggcatattatgacgaatatatgccttatgacaggctg
gaaaaagatgttgcaatgatgaaaaaggcaggaatcaatctggtaaggatcgcggaatcc
acctggagcacactggaaccacaggatggggtgtttgatttttaccatattgaccgggtt
ctggatgccatggaggaggcaggtatccacgtgatcgtgggcacgcctacttatgccatt
ccggcctggatggagaaaaagcatccggatgtgatggcagtgaccaaacagggccggggt
atctacggggcaagacagatcatggacatcaccaaccgccattatttgttttacagtgaa
cgtgtcataagaaaactgatggagcatgtgaaggacagagcgtgtgtcataggctatcag
atcgacaatgagacaaaatattacgggaccgcaggggaacgcgtacaggaggcatttact
gcttatttgaaagataaattccggggtgatgtggaggcgatgaaccgggaattcggcatg
aattactggagcaacgccctgcactcctgggaggattttcccgatgtgagagggactatc
aacggcagtctgggctgtgaatttgaaaaattccagcggggcctggtgacggaatttctg
tcctggcaggcagcccttgtgggggaatataagagggaagaccagtttgtcacacaaaac
tttgattttgagtggaggaaccattcctttggtgtacagccggaggtaaaccatttccat
gtatccaaatgcctggatgttgcagggtgtgatatctatcatccaacccagtcaaagctc
acggggaaggagatcgcttttggcggggatttgacacgttccttaaagcaggacaactac
tatgtgctggagaccgaggctcagggctttacccagtgggtgccttatgacggacagctc
aggctgcaggcattttcccatctggcaggcggagcggactgtgtggaatactggcactgg
cactccatccacaattcctttgagacttactggagggggctgttaagccatgattttgcc
gagaacaagacatatggggaagcagtggtcatcggaaatgaaatgaagcgtctgggaagc
catttgctccatttgaaaaaagagaataaggctgccattatggtgagcaatgaagcgctg
tcaggtctgaaatggttcccgatccagggcagtctggagcagaagaaatcctacaacgat
gtggtgcgctggatttatgatgccctttatgagatgaatgtggaatgtgattttgtgtca
ccggaggcggaaaatctggaagattataagatgctgatccttcccgcgctctactgtgtg
ccggaggagacgcttgtcaggatccggagatttacggagaacggcggatgtcttctgggt
acgttcaagactgcttatgccaatgagaatgtgaaagtttaccacgattcccagcctcat
atcctgtctgaatgctttgggatcctgtataatcagtttacatacccggaggatacatac
ctggaaggcaggctttgcagcagagaggagaaagagggagcagaggtattcatggaatgt
attcagacaaagggggcagagacggttcttcggtatgtgcatgacaactggggccagtat
gccgcagtgacagagaatacgttcggcaaaggaaaagccgtgtacctgggatgcatgttc
agcccaaaactgctgaaaaaactgttggaagaacttttaaaagactgccagatccatccg
aatccaggttcctgcggattcccggtcattgtgcggggcggcagaaaccaaatgggaaaa
caggtgtattatttcctcaactattccggagagaaacaggaggctgcgtgcccggaggga
acatggacagagctgttttcaggggagaccaagagggcaggggaaacgttgttattacag
aaatggaaccttttgatcctggaagaacaataa

DBGET integrated database retrieval system