KEGG   Bipolaris zeicola: COCCADRAFT_699Help
Entry
COCCADRAFT_699    CDS       T03110                                 

Definition
(RefSeq) hypothetical protein
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
bze  Bipolaris zeicola
Pathway
bze00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:bze00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    COCCADRAFT_699
Enzymes [BR:bze01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     COCCADRAFT_699
Chromosome [BR:bze03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     COCCADRAFT_699
   HMT complexes
    COMPASS/SET1 complex
     COCCADRAFT_699
    COMPASS/SET1 complex (yeast)
     COCCADRAFT_699
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET_assoc SET RRM_1 Cutinase
Motif
Other DBs
NCBI-GeneID: 19150645
NCBI-ProteinID: XP_007706990
JGI: 699
UniProt: W6YTH9
LinkDB All DBs
Position
Unknown
AA seq 1177 aa AA seqDB search
MSRSGHNNSLHALTPLTSSDSSPPGKLPSPRSSKLSHETMHATSSSLRAAPSSASNNVAD
TITPINTPPESRRSVFPADGVLGQRSTYDAQLDPKLDRRARAKGTAKYSTILDKGDASPP
PDPRLAIAGYTTGNYVIKTSFTGAPKSKLRIAPYVAKPYSFDQRISCGPGPATQVVVTGF
DPLTPDVQLRSFFSAYGEVETVHNQVHPDNGSPLGICLVKFRDTPPGRGTTGMKASTSAK
RAEREGTNQRLAQHTIKVQSDREGRRCSKLVDVAVQQSRKEEEKLRAKHATKTAAPTAPA
NFDLPANVPKGPSGKGARPPMPMMREPLTRKAALSYLIEREPIKPTLKRKPYIFIAHAYV
PVLSTTIEHLKKRLKNFRWSSVRCDQTGYYVTFEESKRGEDETVRCYKECHMQALFTYVM
NMECNQYGDPNYERSPSPERVIADKKRKAMEKRIEEEEAEDLEWEKKQRADSLDPVRAAL
DVLKQELQEKLLGDIKTKLAAPTILELLDPELHVEKRRKYNIPGPPKKDEDVRPPALLAP
GFDAFGAGTPRGRNGGLGGRGGRRGFGAYDPSTRRGKKPPKVVNAFADERRKASAPKPRV
ARGLHRQMLEMFEPEESDDENRSQLTRGTEEQESRPISRAPSTDIEDEVEESSRAHRAKR
RRIETGWGEESDEEMDDSHARSLLAHCIHKDPENMAEKELEQVLAILPRSSPIWKKADKA
LKGFRRLRKIEQEADVIFGVEGSPMDKTEPEVIVTQDEEANKSIETTELPETLTSLKKKA
AKPKRKTKKQLQEEAKAAKVEVTEIEVPAEEEAPEVKEVAEIAEEAVVEETTPEQDERAS
SVCWSISHDIPRKTVDDDFSVVMDIDGWQHLLKDEEDLRLLKQAVESIAPASIGDAQSWA
WKQKSIKHLNRNGQEGVSRTETKIEGYYVPNATGSARTEGIKKIRESEKSKYLPHRIRVQ
KEREERQRRAKQEERSVVSVEGFKFQTSANKASTANSRANRANNRRMVNDINISKNLSGA
EGDALRFNQLKKRKKLVKFDRSAIHNWGLYAQEPIAVNDMIIEYVGEKVRQRVADLREAK
YDMQGVGSSYLFRIDEDTVIDATKMGGIARFINHSCTPNCTAKIIRVDNTKRIVIYALRD
IQSDEELTYDYKFEREIDATDRIPCLCGSIGCKGFLN
NT seq 3534 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgctctggtcacaacaattcactgcacgccctcacacccttgaccagctcagat
tcttctccgcctggcaagttgcccagcccgcggtcttccaagctctcacatgagacgatg
cacgcgacctcatcctccctacgcgccgccccatcaagcgcatccaacaatgtcgccgac
accattacacccataaacactccgcccgagtcacgcagatccgtcttcccggccgacggc
gtgctgggccagcgctccacctacgatgcacagcttgacccaaaactcgatagacgggcg
agggcgaagggaacggcgaaatatagtacaatactggacaagggcgacgcatctcctcct
cccgacccgcgcctggccattgccggctataccaccgggaactatgtcattaagacttct
ttcacaggtgccccgaaatcgaaactcaggatagcgccctatgtagccaagccctactct
ttcgaccagcgcatatcatgtggtccaggacctgcgacccaagtggtcgtcacaggattt
gatcctctgactccagatgtccagctccgcagtttcttctccgcctacggtgaggtagag
actgtgcacaaccaagtacaccccgacaatggcagtccacttgggatatgtttggtcaaa
tttcgcgacactccgcccggtcgtggcactactggcatgaaagccagtacctcggcaaaa
agagctgagcgagaaggcaccaaccagcgtcttgctcagcacacgatcaaggtacaatcg
gatcgcgaaggtcgaagatgttcaaaattggtggatgtagcagtgcagcaaagccgcaag
gaagaagagaagctacgagccaagcatgctacgaaaacagccgcgcccaccgctcctgca
aactttgacctgccagccaatgttccaaagggaccctctgggaagggcgctcgtccaccg
atgccgatgatgcgggaaccgttgacacgaaaagcagcgctttcgtacctcatcgagcga
gagccgatcaaacccacgctgaaacgaaagccttatatcttcatcgcacacgcatacgta
cctgtcctcagcaccacgattgaacatttgaagaagcgattgaagaacttccggtggtct
tcggtacgatgcgaccaaacaggttattatgtgacatttgaagaatcgaagcgcggcgag
gacgagacggttcgatgctacaaggagtgccacatgcaggctctgttcacctatgtcatg
aacatggaatgtaaccaatatggcgatcccaactatgaacgaagtcctagtcccgagcgt
gtaattgccgacaaaaagcgaaaggccatggaaaagcgaatagaagaggaagaggcagag
gacctggagtgggaaaagaagcagagggcagactcactggaccctgtacgagctgcgttg
gacgttctgaagcaggagttgcaggaaaagcttcttggagacatcaagactaaacttgcc
gcgcctacgatactcgaactactggaccctgagttgcacgtcgagaagcgccgaaagtac
aacatcccgggtccgccaaagaaggacgaggatgttcggcccccagcgctgctcgcccca
ggctttgatgctttcggtgcaggtactccgagaggtcgcaatggaggccttggtggccgt
ggtggtcgtagaggatttggtgcttatgaccccagcacgagacgtggaaagaaacctccg
aaggttgtcaatgcgtttgccgacgaacgaagaaaggcatctgcgcccaagcctcgtgtg
gctcgtggtttgcatcgccaaatgcttgaaatgtttgaaccagaagaatcggatgacgaa
aaccgcagccagttgacacgcggcaccgaggagcaagagagcagacctattagccgagct
ccttctacggacatcgaagatgaagtggaagagtcgtcgagagctcatcgtgccaagcga
cgtcgcattgagactggctggggtgaagagagtgatgaggagatggacgattcgcacgcg
agaagtttgcttgctcactgtattcacaaagaccctgaaaacatggcggagaaagagctg
gaacaagttctcgcaattctcccacgctcatcgccaatctggaagaaggccgacaaagcg
ctcaagggtttcagaaggctgcggaagattgaacaagaggcagacgtcatctttggtgtc
gaaggaagcccgatggacaagacggagcccgaagtaattgtcactcaagatgaagaggcc
aacaagtctatcgagactacagaacttcccgaaacactgacatcgctcaagaagaaggct
gccaagccaaagagaaagaccaagaagcaacttcaggaagaagcaaaggctgcaaaggtg
gaagttacggagattgaagtacctgcggaagaggaggcacctgaagtcaaggaggttgcg
gagatcgctgaagaggcagtggttgaggaaactactccagagcaagatgagcgggcctct
tctgtctgctggagcatatcccatgacatacctcgcaagacagttgatgatgactttagc
gttgtcatggacattgatggttggcaacatctgctcaaggatgaagaagatttgcgtctt
ctcaagcaagccgttgaatctatcgctcccgccagtatcggagacgctcaatcgtgggcc
tggaagcaaaagtccattaagcatctcaaccgtaatggccaggagggtgtttcccgcact
gagaccaagattgaaggatactacgttcccaacgcaactggctcagctcgtacagaaggt
atcaagaagattcgcgaatccgaaaagtcgaaatacctgcctcatcgtattcgcgtacaa
aaggagcgcgaagaacgccaacgtcgtgccaagcaagaagagcgaagcgtcgtgtcggtt
gaaggctttaaattccagacaagtgccaacaaggcgtcgaccgcaaactcgcgtgccaac
cgtgccaacaaccgccgcatggtcaacgacattaatatctccaagaacctttctggagct
gagggtgacgctctccgcttcaatcagctcaagaagcgcaagaagctggtcaagtttgac
cgttcagccatccacaactggggtctgtacgcccaggaaccgattgccgtcaacgacatg
attatcgagtacgttggtgaaaaggtccgacagcgtgtggccgatctccgagaagccaag
tacgacatgcaaggcgtgggatcaagttacctgttccgaattgacgaagatactgtcatt
gatgcgacaaagatgggcggtattgcccgttttatcaatcactcttgcacgcccaattgc
acagccaagattatccgcgtcgacaacaccaagcgtattgtcatttatgcgttgagggat
attcagtctgacgaggaactcacctacgactacaagttcgagcgtgaaatcgatgccacg
gatcgtattccttgtctctgcggctcaatcggttgcaagggcttccttaattag

DBGET integrated database retrieval system