KEGG   Bipolaris zeicola: COCCADRAFT_86955Help
Entry
COCCADRAFT_86955  CDS       T03110                                 

Definition
(RefSeq) glycosyltransferase family 3 protein
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
bze  Bipolaris zeicola
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bze00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    COCCADRAFT_86955
Enzymes [BR:bze01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     COCCADRAFT_86955
Glycosyltransferases [BR:bze01003]
 Polysaccharide
  Storage polysaccharide
   COCCADRAFT_86955
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 704 aa AA seqDB search
MASGARDVQNHVLFEVATEVANRVGGIYSVLKSKAQVTTAEYGAAYTLLGPWNRASAAVE
VEPIVPKDPALLATIKSMDERGIKTLYGRWLIDGAPRVLLFDTGTGYRWLDEWKGDLWSS
TGIPSPPGDSETNEAIVFGYLIAWFLGEYVYHEKQRAVIVQFHEWLAGVAVPLCKKRRID
VTTIFTTHATLLGRYLCAGSVDFYNNLQYFDVDAEAGKRGIYHRYCIERAATHAADVFTT
VSHITAYESEHLLKRKPDGVLPNGLNVKKFSATHEFQNLHQQAKVKINDFVRGHFYGHND
FDPENTLYFFTAGRYEYRNKGVDMFIESLARLNHKMKSENSNMTVVAFIILPAQTTSLSV
DSLKGQAVIKALHDSVNNIAENVAKKLFERSLTWTEGSELPEDKDLITPADKILLRRRLF
AMKRHNLPPIVTHNMVNDAEDPVLNQLRRCQLFNHPSDRVKVVFHPEFLNSANPVLPMDY
DDFVRGTHLGVFSSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENAQDYGIYIV
DRRMKGVDDSVNQLVDYMFEFTKKSKRQRINQRNRTERLSDLLDWKRMGLEYVKARQLAL
RRAYPAAYEDDEEPDFFNSQDVKISRPLSEPGSPRERSGMMTPGDFASLQEGREGLSTED
YIAWKLPEEEEADDFTFPLTLKTKSKPNSGATTPTLPAAVNGTD
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgggagcgcgagacgtgcagaaccacgtcctgttcgaggttgcgaccgaagtc
gcaaacagagtcggcggcatctactcggtcctcaagtcaaaggcccaggtcaccacagca
gagtatggcgctgcttacactctgctcggtccctggaatagggcttcggccgccgtcgaa
gtagaacccattgttcccaaagaccctgctctgctggccacgatcaagtccatggacgag
cggggcatcaagacgctatacggacgatggctgattgacggtgccccacgcgtgctcctc
tttgacactggcactggctacaggtggctcgatgagtggaagggcgacctctggtcttct
actggcattccttcgcctcctggcgattccgagaccaatgaggccattgtctttggctat
cttatcgcctggtttttgggcgagtatgtctaccatgagaagcagcgagctgtcattgtc
cagttccacgagtggctggcaggtgttgcagtgcccctttgcaagaagcgccgcatcgac
gtgactaccattttcacaactcacgccacacttctcggtcgctacctttgcgctggctca
gtcgacttttacaacaatctgcaatactttgacgtggatgccgaagcaggaaagcggggt
atctaccatcgttactgcattgagcgggctgccacgcacgctgccgacgtcttcacaacc
gtgtcccacatcactgcctatgagagcgagcatctcttgaagcgcaaaccagatggtgta
ttgcccaacggtctcaacgttaagaagttttctgcgacgcacgagttccagaacttgcac
caacaggcaaaggtcaagatcaacgactttgtgcgcggacatttctacggtcacaatgac
ttcgatcctgagaatacgctctacttcttcacagctggtcgctacgagtaccggaataag
ggtgtggacatgtttatcgaatcactggcacgactgaaccacaagatgaagagcgagaac
tctaacatgacggtcgttgcttttatcattctgcctgcacagactacctctctttcggtc
gactcactcaagggacaggcagtcatcaaggcgctccacgacagtgtgaacaacattgcc
gagaacgtggccaagaagctgtttgagcgctccctgacttggacagaaggctcggagctc
cctgaagacaaggacttgatcacacctgctgataagattctgctccgccgaagattgttc
gccatgaagcgccataacctgccacctattgtcactcacaacatggtcaacgatgccgaa
gatcctgtgctcaaccaactgcgtcgctgccagctcttcaaccacccctcggaccgcgtc
aaggttgttttccaccctgagtttttgaactcggccaaccccgtactgcccatggactac
gacgactttgtccgtggaacccatcttggtgtattctcatcttactacgagccatgggga
tacactccagccgagtgcactgtcatgggtgttccaagtatcacaacaaacctgtctggt
tttggttgctacatggaggagctgattgagaatgctcaagactacggtatctacattgta
gatcggagaatgaagggcgttgacgactcggtcaaccagctcgtcgactacatgtttgaa
ttcacaaagaagagcaagcgccagcgcatcaaccagcggaatcggacagagcgtctcagt
gacctactcgactggaagcgcatgggcttggagtatgtcaaggctcgacaactggcgctc
cgacgagcataccctgcggcgtacgaagacgacgaggagcccgacttcttcaactcgcaa
gacgtcaagatttcccggcctctatccgagcctggatcgccccgtgagcgttcaggtatg
atgactcctggtgactttgcttcgctgcaagaaggccgtgagggactgagcaccgaggac
tacattgcgtggaagcttcctgaagaggaagaggccgacgactttactttcccacttacc
ctgaagacgaagagcaagcccaactctggcgcaaccacacctaccttgcctgctgcggta
aatggaactgactag

DBGET integrated database retrieval system