KEGG   Bipolaris zeicola: COCCADRAFT_96085Help
Entry
COCCADRAFT_96085  CDS       T03110                                 

Definition
(RefSeq) hypothetical protein
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
bze  Bipolaris zeicola
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:bze00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    COCCADRAFT_96085
Enzymes [BR:bze01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     COCCADRAFT_96085
Chromosome [BR:bze03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     COCCADRAFT_96085
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    COCCADRAFT_96085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 521 aa AA seqDB search
MPSMVVIPSNGYTRRRVLVDRVHSIVSNRVQKDDEQYLVRWNTDDASDQAPLSWHSIKEL
LRCLEHVQDYLEVREKSTELLEHVQPTTKKRKTPDSGLEDERRSSPFDPRLYQAQHGGQT
PSFSQSPTATPPPPSPPDVYNGVLDADEHGYIFCRTSTRPDIPKLDISNFPTPYMKHTAQ
RSSVDKALAYIRNEYIRRLSKVTGKDSKPIKLVNLVDSSTPSLRFRYISDCILRPGVIRA
PPETQTGCQSCSPHMGRDIGCEYTRKCDCLEYAAVDESRLTDSQVLEYQHALANGLSTMG
FPKRFPYYAAGTKRERTGCLVSFYLQSRNPVYECNDKCNCGRHCRNKNVQFGRQVEVEIF
RSADGRGWGLRCTEDLHEGQFIDTYRGEIITDAEAERRENASSSKSKASYLYSLDKFRES
EGLDDKDLYVVDGEFMGGPTKFINHSCDPNCRQYTVSYNRHDVRIYDIAFFACRFIPAGE
ELTFDYLDKDDGGEEEEMDEPGEGAIPCLCGTKKCRKWLWT
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccatggtcgttataccatcaaatggctatacgaggcggcgcgtcctcgtcgat
cgcgtccactcgatagtctcaaatcgcgtgcaaaaggatgacgaacaatacctagtccgg
tggaacaccgatgatgcgtcagatcaagcgccgctaagctggcattcgatcaaagaactc
ttgcgatgtctcgaacacgtccaagattaccttgaagtgagagagaagtctacggaatta
ctggaacacgtgcaacctacaaccaaaaagcgcaaaacaccagacagtggcctggaggat
gaacgccgctcttcaccgtttgatcctcgcctttaccaagcacaacatggaggtcagacg
ccgtcgttctctcagtctccgacagcaacacctccgcctccatctccacctgatgtatac
aacggcgtcctagatgccgacgagcatggatacatcttctgccgtacatctacaagacca
gatataccaaagcttgacatcagcaacttcccaacaccatatatgaagcatacagcgcaa
agatccagcgtcgacaaagccctcgcctacatccgcaacgagtacatccggcgactctcc
aaagtcacgggcaaagacagcaaaccaatcaaactagtcaacctcgtagactcctccacc
ccgtccctccgcttccgctacatctcagactgcatcctccgacccggcgtcatccgcgca
cccccagagacgcaaacaggctgccagtcatgctcgccgcacatgggccgtgacatcggc
tgcgaatacacgagaaaatgcgactgtctcgagtacgccgccgtcgacgaatcacgcctc
acagactctcaagtcctcgagtaccaacacgccctcgccaacggcctgtcaaccatgggt
ttcccaaaaaggtttccgtactacgctgcgggcacaaagcgcgagcgcacaggctgtctc
gtttcattctatctgcagtcgcgcaacccagtctacgaatgcaacgacaagtgcaactgc
gggcgccactgccgcaacaaaaacgtgcagtttggtcggcaagtcgaagtcgaaatcttt
cgctccgctgacggtcgcggctggggtctccgctgcaccgaggacctgcacgagggccaa
ttcatcgatacctaccgtggcgaaatcatcaccgacgccgaagctgaacgccgtgaaaac
gcttcctcctccaaatcaaaagcttcgtacctttactccctggataaattcagggaatca
gagggcctcgacgataaggatctgtatgttgtcgacggcgagttcatgggtgggccaacc
aaattcataaatcactcttgcgacccgaattgtcgccagtatacggtgagttataatcgc
catgatgttaggatttacgatattgcgttctttgcgtgtaggtttatcccggcgggcgag
gaacttacgtttgattatctggataaggatgatgggggtgaggaggaggagatggatgag
ccgggcgagggcgctattccgtgtctttgtgggactaagaagtgtaggaagtggttgtgg
acgtga

DBGET integrated database retrieval system