KEGG   Cutibacterium acnes: RN83_09390Help
Entry
RN83_09390        CDS       T04624                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cacn  Cutibacterium acnes
Brite
Enzymes [BR:cacn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     RN83_09390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2031968..2032585
Genome map
AA seq 205 aa AA seqDB search
MAVYTLPDLDYDYGALEPHISGKIMELHHDKHHNTYVQGANTALEKLAEAREKGDFGTIN
KLEKDLAFNLGGHINHSVFWKNMSPHGGGRPEGNELAAAIDEFFGSFDSFKKQFEETAKG
VQGSGWGMLVWDVMGQRLNTMQLFDHQGNLPSTQIPVVQLDMWEHAYYLQYQNVKADYVT
AWWNVVNWTDAEQRFVKARSITGLF
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggctgtttacacccttcccgatctcgactacgactacggcgcactggagccccacatc
tcgggcaagatcatggaactgcaccatgacaagcaccacaacacctacgttcagggagcc
aacaccgccctagagaagctggccgaggcccgcgagaagggcgacttcggaaccatcaac
aaactcgagaaggacctggcctttaacctcggcggccatatcaaccactccgtgttctgg
aagaacatgtccccccatgggggcggtcgtccggagggcaacgaactcgccgctgcgatt
gacgagttcttcggttcctttgacagcttcaaaaagcagtttgaggaaaccgctaagggc
gttcagggctccggctggggcatgctcgtgtgggacgtgatgggtcagcgactcaacacc
atgcagctgtttgaccaccagggcaatctgccgtcaacccagatcccggtcgtccagctc
gacatgtgggaacacgcctattacctgcagtaccagaacgtcaaggccgactacgtcacc
gcctggtggaacgtcgtcaactggaccgacgccgagcagcggttcgtcaaggcccgttcg
atcaccggtttgttctga

DBGET integrated database retrieval system