KEGG   Citrobacter amalonaticus FDAARGOS_165: AL524_15775Help
Entry
AL524_15775       CDS       T04738                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
caf  Citrobacter amalonaticus FDAARGOS_165
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:caf00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AL524_15775
Enzymes [BR:caf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AL524_15775
Transporters [BR:caf02000]
 Other Transporters
  Pores ion channels [TC:1]
   AL524_15775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3274054..3274659
Genome map
AA seq 201 aa AA seqDB search
MKLFYKPGACSLASHITLRESGKDFTLDGVDLMKKRLENGDDFFAVNPKGQVPALLLDDG
TLLTEGVAIMQYLADSVPDRQLLAPVSSISRYKTLEWLNYIATELHKGFTPLFRPDTPEE
YKPTVRALLEKKMQYVDAALKEGQWICGSRFTIADAYLFTVLRWAYAVKLNMDGLENIAA
YMKRMAERPGVAAALKAEGIQ
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctacaagccaggcgcctgctctcttgcctcccatattacccttcgcgag
agtgggaaagatttcacgctggatggcgtggatttgatgaaaaagcgtctggaaaacggc
gatgattttttcgcggtcaacccgaaaggacaggttcccgctttgctgctcgatgatggt
acgctgctgaccgaaggcgtggcgataatgcaatatctcgccgacagcgttcctgatcgc
cagttgctggctcccgtaagcagcatttcacgctacaagacgctggaatggcttaactac
attgcgactgaactgcataaaggcttcacgccgctgtttcgccctgacactccagaagag
tataaaccgaccgttcgcgcgcttcttgagaagaaaatgcagtacgttgatgccgctctc
aaagagggacaatggatttgtggctcgcgtttcactatcgcggatgcctaccttttcacc
gtactgcgctgggcgtatgcggtaaaactcaatatggacgggttagagaatattgcggca
tatatgaaacgaatggctgagcgtccgggcgttgcggcagcgctgaaggcggaaggaata
cagtaa

DBGET integrated database retrieval system